Gene/Proteome Database (LMPD)
Proteins
2-acylglycerol O-acyltransferase 2 | |
---|---|
Refseq ID | NP_001102906 |
Protein GI | 210031518 |
UniProt ID | B2RZ21 |
mRNA ID | NM_001109436 |
Length | 334 |
MVEFAPLLVPWERRLQTFAVLQWVFSFLALAQLCIFIFIGLLFTRFWLFSVLYATWWYLDWDRPRQGGRPIQFFRRMAIWKYMKDFFPVSLVKTAELDPSRNYIAGFHPHGVLAAGAFLNLCTESTGFTSLFPGIRSYLMMLTVWFRAPIFRDYIMSGGLVSSEKVSADHILSRKGGGNLLAIIVGGAQEALDARPGAYRLLLKNRKGFIRLALTHGAALVPIFSFGENNLFNQVENTPGTWLRWIQNWLQKIMGISLPLFHGRGVFQYSFGLVPFRQPITTVVGKPIEVQMIPHPSEEEVNRLHQLYIKELCKLFEEHKLKFNVPEDQHLEFC |
Gene Information
Entrez Gene ID
Gene Name
monoacylglycerol O-acyltransferase 2
Gene Symbol
Species
Rattus norvegicus
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0005783 | IEA:Ensembl | C | endoplasmic reticulum |
GO:0016407 | IEA:Ensembl | F | acetyltransferase activity |
GO:0006651 | IEA:Ensembl | P | diacylglycerol biosynthetic process |
GO:0050892 | IEA:Ensembl | P | intestinal absorption |
KEGG Pathway Links
Domain Information
InterPro Annotations
Accession | Description |
---|---|
IPR007130 | Diacylglycerol acyltransferase |
UniProt Annotations
Entry Information
Gene Name
monoacylglycerol O-acyltransferase 2
Protein Entry
B2RZ21_RAT
UniProt ID
Species
Rat
Identical and Related Proteins
Unique RefSeq proteins for LMP013625 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
210031518 | RefSeq | NP_001102906 | 334 | 2-acylglycerol O-acyltransferase 2 |
Identical Sequences to LMP013625 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:210031518 | GenBank | EDM18418.1 | 334 | rCG39457, isoform CRA_b [Rattus norvegicus] |
GI:210031518 | GenBank | AAI66995.1 | 334 | Mogat2 protein [Rattus norvegicus] |
Related Sequences to LMP013625 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:210031518 | EMBL | CBV04418.1 | 334 | unnamed protein product [Mus musculus] |
GI:210031518 | EMBL | CBU92412.1 | 334 | unnamed protein product [Mus musculus] |
GI:210031518 | GenBank | EDM18418.1 | 334 | rCG39457, isoform CRA_b [Rattus norvegicus] |
GI:210031518 | GenBank | AAI66995.1 | 334 | Mogat2 protein [Rattus norvegicus] |