Gene/Proteome Database (LMPD)

LMPD ID
LMP013642
Gene ID
690388
Species
Rattus norvegicus (Rat)
Gene Name
phospholipase A2, group IIF
Gene Symbol
Pla2g2f
Alternate Names
group IIF secretory phospholipase A2;
Chromosome
5
Map Location
5q36

Proteins

group IIF secretory phospholipase A2
Refseq ID NP_001103057
Protein GI 157818973
UniProt ID D3ZLB5
mRNA ID NM_001109587
Length 210
MADGAQANPKGFRKKVLVKRSTGQKDPRLRASPSKTSRSSLGMKKFFAIAVLAGSVVTTAHSSLFNLKSMVEAITHRNSILSFVGYGCYCGLGGRGHPMDEMDWCCHAHDCCYQKLFDQGCRPYVDHYDHRIENDTEIVCTELNETECDKQTCDCDKNLTLCLKDHPYSEKYRGYLNVYCHGPTPNCSIYDPYPEEVTCGHGLSTNPVST

Gene Information

Entrez Gene ID
690388
Gene Name
phospholipase A2, group IIF
Gene Symbol
Pla2g2f
Species
Rattus norvegicus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005576 IEA:UniProtKB-KW C extracellular region
GO:0005509 IEA:InterPro F calcium ion binding
GO:0004623 IEA:InterPro F phospholipase A2 activity
GO:0016042 IEA:InterPro P lipid catabolic process
GO:0006644 IEA:InterPro P phospholipid metabolic process

KEGG Pathway Links

KEGG Pathway ID Description
ko00590 Arachidonic acid metabolism
rno00590 Arachidonic acid metabolism
ko00565 Ether lipid metabolism
rno00565 Ether lipid metabolism
ko04975 Fat digestion and absorption
rno04975 Fat digestion and absorption
ko00564 Glycerophospholipid metabolism
rno00564 Glycerophospholipid metabolism
ko00591 Linoleic acid metabolism
rno00591 Linoleic acid metabolism
rno01100 Metabolic pathways
ko04972 Pancreatic secretion
rno04972 Pancreatic secretion
rno04014 Ras signaling pathway
ko04270 Vascular smooth muscle contraction
rno04270 Vascular smooth muscle contraction
ko00592 alpha-Linolenic acid metabolism
rno00592 alpha-Linolenic acid metabolism

REACTOME Pathway Links

REACTOME Pathway ID Description
5954464 Acyl chain remodelling of PC
5954471 Acyl chain remodelling of PE
5954465 Acyl chain remodelling of PG
5954468 Acyl chain remodelling of PI
5954470 Acyl chain remodelling of PS
5953473 Glycerophospholipid biosynthesis
5953250 Metabolism
5953289 Metabolism of lipids and lipoproteins
5953474 Phospholipid metabolism
5953472 Synthesis of PA

Domain Information

InterPro Annotations

Accession Description
IPR001211 Phospholipase A2
IPR016090 Phospholipase A2 domain
IPR013090 Phospholipase A2, active site

UniProt Annotations

Entry Information

Gene Name
phospholipase A2, group IIF
Protein Entry
D3ZLB5_RAT
UniProt ID
D3ZLB5
Species
Rat

Comments

Comment Type Description
Catalytic Activity Phosphatidylcholine + H(2)O = 1- acylglycerophosphocholine + a carboxylate
Cofactor Note=Binds 1 calcium ion per subunit. ;
Similarity Belongs to the phospholipase A2 family
Subcellular Location Secreted .

Identical and Related Proteins

Unique RefSeq proteins for LMP013642 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
157818973 RefSeq NP_001103057 210 group IIF secretory phospholipase A2

Identical Sequences to LMP013642 proteins

Reference Database Accession Length Protein Name
GI:157818973 GenBank EDL80886.1 210 rCG30768 [Rattus norvegicus]

Related Sequences to LMP013642 proteins

Reference Database Accession Length Protein Name
GI:157818973 GenBank AAI25568.1 210 Phospholipase A2, group IIF [Mus musculus]
GI:157818973 GenBank EDL80886.1 210 rCG30768 [Rattus norvegicus]
GI:157818973 RefSeq NP_036175.2 210 group IIF secretory phospholipase A2 [Mus musculus]
GI:157818973 RefSeq XP_008762511.1 283 PREDICTED: group IIF secretory phospholipase A2 isoform X1 [Rattus norvegicus]