Gene/Proteome Database (LMPD)

LMPD ID
LMP013649
Gene ID
Species
Rattus norvegicus (Rat)
Gene Name
ABO blood group (transferase A, alpha 1-3-N-acetylgalactosaminyltransferase; transferase B, alpha 1-3-galactosyltransferase)
Gene Symbol
Synonyms
Abo2;
Alternate Names
histo-blood group ABO system transferase 2; NAGAT 2; a transferase; b transferase; cis-AB transferase 2; histo-blood group A transferase; histo-blood group B transferase; b blood group galactosyltransferase; blood group A glycosyltransferase 2; putative blood group A transferase T2; transferase B, alpha 1-3-galactosyltransferase); fucosylglycoprotein 3-alpha-galactosyltransferase; fucosylglycoprotein alpha-N-acetylgalactosaminyltransferase; glycoprotein-fucosylgalactoside alpha-galactosyltransferase; glycoprotein-fucosylgalactoside alpha-N-acetylgalactosaminyltransferase; ABO blood group (alpha 1-3-N-acetylgalactosaminyltransferase, alpha 1-3-galactosyltransferase);
Chromosome
3
Map Location
chromosome:3
EC Number
2.4.1.40

Proteins

histo-blood group ABO system transferase 2
Refseq ID NP_001153735
Protein GI 237681192
UniProt ID Q8CFC4
mRNA ID NM_001160263
Length 334
MKDLRFGRLKCYSLHLGILPLTVLVLVFFCFVCLSLRSQEWGHPGAVNRKAYPQPRVLTPTRTDVLVLTPWLAPIIWEGTFDIDTLNEQFRLRNTTIGLTVFAVKKYVVFLKLFLETAEQHFMVGHKVIYYVFTDRPADVPQVPLGAGRRLVVLTVRNYTRWQDVSMHRMEVISHFSEQRFRHEVDYLVCADVDMKFRDHVGVEILSALFGTLHPGFYRSRRESFTYERRPQSQAYIPWDQGDFYYMGAFFGGSVVEVHHLTKACHQAMVEDQANGIEAVWHDESHLNKYLLYHKPTKVLSPEYMWDQQLLGWPSIMKKLRYVAVPKNHQAIRN

Gene Information

Entrez Gene ID
Gene Name
ABO blood group (transferase A, alpha 1-3-N-acetylgalactosaminyltransferase; transferase B, alpha 1-3-galactosyltransferase)
Gene Symbol
Species
Rattus norvegicus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005794 IDA:RGD C Golgi apparatus
GO:0031410 IDA:RGD C cytoplasmic vesicle
GO:0005576 IEA:UniProtKB-KW C extracellular region
GO:0016021 IEA:UniProtKB-KW C integral component of membrane
GO:0001962 IDA:RGD F alpha-1,3-galactosyltransferase activity
GO:0004381 IEA:UniProtKB-EC F fucosylgalactoside 3-alpha-galactosyltransferase activity
GO:0004380 IDA:RGD F glycoprotein-fucosylgalactoside alpha-N-acetylgalactosaminyltransferase activity
GO:0046872 IEA:UniProtKB-KW F metal ion binding
GO:0051691 IMP:RGD P cellular oligosaccharide metabolic process
GO:0043066 IMP:RGD P negative regulation of apoptotic process
GO:0008284 IMP:RGD P positive regulation of cell proliferation
GO:0006486 IEA:UniProtKB-UniPathway P protein glycosylation
GO:0009624 IEP:RGD P response to nematode
GO:0032526 IEP:RGD P response to retinoic acid

KEGG Pathway Links

KEGG Pathway ID Description
ko00601 Glycosphingolipid biosynthesis - lacto and neolacto series
rno00601 Glycosphingolipid biosynthesis - lacto and neolacto series
rno01100 Metabolic pathways

Domain Information

InterPro Annotations

Accession Description
IPR005076 Glycosyl transferase, family 6
IPR029044 Nucleotide-diphospho-sugar transferases

UniProt Annotations

Entry Information

Gene Name
ABO blood group (transferase A, alpha 1-3-N-acetylgalactosaminyltransferase; transferase B, alpha 1-3-galactosyltransferase)
Protein Entry
BGAT2_RAT
UniProt ID
Species
Rat

Comments

Comment Type Description
Catalytic Activity UDP-N-acetyl-alpha-beta-D-galactosamine + glycoprotein-alpha-L-fucosyl-(1->2)-D-galactose = UDP + glycoprotein-N-acetyl-alpha-D-galactosaminyl-(1->3)-(alpha-L- fucosyl-(1->2))-beta-D-galactose.
Catalytic Activity UDP-alpha-D-galactose + alpha-L-fucosyl- (1->2)-D-galactosyl-R = UDP + alpha-D-galactosyl-(1->3)-(alpha-L- fucosyl-(1->2))-D-galactosyl-R.
Cofactor Name=Mn(2+); Xref=ChEBI:CHEBI:29035; Evidence= ; Note=Binds 1 Mn(2+) ion per subunit. ;
Domain The conserved DXD motif is involved in cofactor binding. The manganese ion interacts with the beta-phosphate group of UDP and may also have a role in catalysis.
Function Posseses strong B transferase activity and a weak A transferase activity
Pathway Protein modification; protein glycosylation.
Similarity Belongs to the glycosyltransferase 6 family
Subcellular Location Golgi apparatus, Golgi stack membrane; Single-pass type II membrane protein. Secreted. Note=Membrane- bound form in trans cisternae of Golgi. Secreted into the body fluid (By similarity)
Tissue Specificity Large intestine, caecum, stomach, pancreas, submaxillary gland and kidney (at protein level). Ubiquitous. {ECO:0000269|PubMed:12180981, ECO:0000269|PubMed:12237302, ECO:0000269|PubMed:12799344}.

Identical and Related Proteins

Unique RefSeq proteins for LMP013649 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
237681192 RefSeq NP_001153735 334 histo-blood group ABO system transferase 2

Identical Sequences to LMP013649 proteins

Reference Database Accession Length Protein Name
GI:237681192 DBBJ BAC16248.1 334 histo-blood group ABO transferase [Rattus norvegicus]
GI:237681192 GenBank AAO72725.1 334 B blood group galactosyltransferase [Rattus norvegicus]
GI:237681192 SwissProt Q8CFC4.1 334 RecName: Full=Histo-blood group ABO system transferase 2; AltName: Full=B blood group galactosyltransferase; AltName: Full=Blood group A glycosyltransferase 2; AltName: Full=Cis-AB transferase 2; AltName: Full=Fucosylglycoprotein 3-alpha-galactosyltransferase; AltName: Full=Fucosylglycoprotein alpha-N-acetylgalactosaminyltransferase; AltName: Full=Glycoprotein-fucosylgalactoside alpha-N-acetylgalactosaminyltransferase; AltName: Full=Glycoprotein-fucosylgalactoside alpha-galactosyltransferase; AltName: Full=Histo-blood group A transferase; Short=A transferase; AltName: Full=Histo-blood group B transferase; Short=B transferase; AltName: Full=NAGAT 2; AltName: Full=Putative blood group A transferase T2 [Rattus norvegicus]

Related Sequences to LMP013649 proteins

Reference Database Accession Length Protein Name
GI:237681192 DBBJ BAC16248.1 334 histo-blood group ABO transferase [Rattus norvegicus]
GI:237681192 GenBank AAO72725.1 334 B blood group galactosyltransferase [Rattus norvegicus]
GI:237681192 GenBank EDL93468.1 334 rCG45409 [Rattus norvegicus]
GI:237681192 SwissProt Q8CFC4.1 334 RecName: Full=Histo-blood group ABO system transferase 2; AltName: Full=B blood group galactosyltransferase; AltName: Full=Blood group A glycosyltransferase 2; AltName: Full=Cis-AB transferase 2; AltName: Full=Fucosylglycoprotein 3-alpha-galactosyltransferase; AltName: Full=Fucosylglycoprotein alpha-N-acetylgalactosaminyltransferase; AltName: Full=Glycoprotein-fucosylgalactoside alpha-N-acetylgalactosaminyltransferase; AltName: Full=Glycoprotein-fucosylgalactoside alpha-galactosyltransferase; AltName: Full=Histo-blood group A transferase; Short=A transferase; AltName: Full=Histo-blood group B transferase; Short=B transferase; AltName: Full=NAGAT 2; AltName: Full=Putative blood group A transferase T2 [Rattus norvegicus]