Gene/Proteome Database (LMPD)
LMPD ID
LMP013649
Gene ID
Species
Rattus norvegicus (Rat)
Gene Name
ABO blood group (transferase A, alpha 1-3-N-acetylgalactosaminyltransferase; transferase B, alpha 1-3-galactosyltransferase)
Gene Symbol
Synonyms
Abo2;
Alternate Names
histo-blood group ABO system transferase 2; NAGAT 2; a transferase; b transferase; cis-AB transferase 2; histo-blood group A transferase; histo-blood group B transferase; b blood group galactosyltransferase; blood group A glycosyltransferase 2; putative blood group A transferase T2; transferase B, alpha 1-3-galactosyltransferase); fucosylglycoprotein 3-alpha-galactosyltransferase; fucosylglycoprotein alpha-N-acetylgalactosaminyltransferase; glycoprotein-fucosylgalactoside alpha-galactosyltransferase; glycoprotein-fucosylgalactoside alpha-N-acetylgalactosaminyltransferase; ABO blood group (alpha 1-3-N-acetylgalactosaminyltransferase, alpha 1-3-galactosyltransferase);
Chromosome
3
Map Location
chromosome:3
EC Number
2.4.1.40
Proteins
histo-blood group ABO system transferase 2 | |
---|---|
Refseq ID | NP_001153735 |
Protein GI | 237681192 |
UniProt ID | Q8CFC4 |
mRNA ID | NM_001160263 |
Length | 334 |
MKDLRFGRLKCYSLHLGILPLTVLVLVFFCFVCLSLRSQEWGHPGAVNRKAYPQPRVLTPTRTDVLVLTPWLAPIIWEGTFDIDTLNEQFRLRNTTIGLTVFAVKKYVVFLKLFLETAEQHFMVGHKVIYYVFTDRPADVPQVPLGAGRRLVVLTVRNYTRWQDVSMHRMEVISHFSEQRFRHEVDYLVCADVDMKFRDHVGVEILSALFGTLHPGFYRSRRESFTYERRPQSQAYIPWDQGDFYYMGAFFGGSVVEVHHLTKACHQAMVEDQANGIEAVWHDESHLNKYLLYHKPTKVLSPEYMWDQQLLGWPSIMKKLRYVAVPKNHQAIRN |
Gene Information
Entrez Gene ID
Gene Name
ABO blood group (transferase A, alpha 1-3-N-acetylgalactosaminyltransferase; transferase B, alpha 1-3-galactosyltransferase)
Gene Symbol
Species
Rattus norvegicus
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0031410 | IDA:RGD | C | cytoplasmic vesicle |
GO:0005576 | IEA:UniProtKB-KW | C | extracellular region |
GO:0005794 | IDA:RGD | C | Golgi apparatus |
GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
GO:0001962 | IDA:RGD | F | alpha-1,3-galactosyltransferase activity |
GO:0004381 | IEA:UniProtKB-EC | F | fucosylgalactoside 3-alpha-galactosyltransferase activity |
GO:0004380 | IDA:RGD | F | glycoprotein-fucosylgalactoside alpha-N-acetylgalactosaminyltransferase activity |
GO:0046872 | IEA:UniProtKB-KW | F | metal ion binding |
GO:0051691 | IMP:RGD | P | cellular oligosaccharide metabolic process |
GO:0043066 | IMP:RGD | P | negative regulation of apoptotic process |
GO:0008284 | IMP:RGD | P | positive regulation of cell proliferation |
GO:0006486 | IEA:UniProtKB-UniPathway | P | protein glycosylation |
GO:0009624 | IEP:RGD | P | response to nematode |
GO:0032526 | IEP:RGD | P | response to retinoic acid |
KEGG Pathway Links
Domain Information
UniProt Annotations
Entry Information
Gene Name
ABO blood group (transferase A, alpha 1-3-N-acetylgalactosaminyltransferase; transferase B, alpha 1-3-galactosyltransferase)
Protein Entry
BGAT2_RAT
UniProt ID
Species
Rat
Comments
Comment Type | Description |
---|---|
Catalytic Activity | UDP-alpha-D-galactose + alpha-L-fucosyl- (1->2)-D-galactosyl-R = UDP + alpha-D-galactosyl-(1->3)-(alpha-L- fucosyl-(1->2))-D-galactosyl-R. |
Catalytic Activity | UDP-N-acetyl-alpha-beta-D-galactosamine + glycoprotein-alpha-L-fucosyl-(1->2)-D-galactose = UDP + glycoprotein-N-acetyl-alpha-D-galactosaminyl-(1->3)-(alpha-L- fucosyl-(1->2))-beta-D-galactose. |
Cofactor | Name=Mn(2+); Xref=ChEBI:CHEBI:29035; Evidence= ; Note=Binds 1 Mn(2+) ion per subunit. ; |
Domain | The conserved DXD motif is involved in cofactor binding. The manganese ion interacts with the beta-phosphate group of UDP and may also have a role in catalysis. |
Function | Posseses strong B transferase activity and a weak A transferase activity |
Pathway | Protein modification; protein glycosylation. |
Similarity | Belongs to the glycosyltransferase 6 family |
Subcellular Location | Golgi apparatus, Golgi stack membrane; Single-pass type II membrane protein. Secreted. Note=Membrane- bound form in trans cisternae of Golgi. Secreted into the body fluid (By similarity) |
Tissue Specificity | Large intestine, caecum, stomach, pancreas, submaxillary gland and kidney (at protein level). Ubiquitous. {ECO:0000269|PubMed:12180981, ECO:0000269|PubMed:12237302, ECO:0000269|PubMed:12799344}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP013649 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
237681192 | RefSeq | NP_001153735 | 334 | histo-blood group ABO system transferase 2 |
Identical Sequences to LMP013649 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:237681192 | DBBJ | BAC16248.1 | 334 | histo-blood group ABO transferase [Rattus norvegicus] |
GI:237681192 | GenBank | AAO72725.1 | 334 | B blood group galactosyltransferase [Rattus norvegicus] |
GI:237681192 | SwissProt | Q8CFC4.1 | 334 | RecName: Full=Histo-blood group ABO system transferase 2; AltName: Full=B blood group galactosyltransferase; AltName: Full=Blood group A glycosyltransferase 2; AltName: Full=Cis-AB transferase 2; AltName: Full=Fucosylglycoprotein 3-alpha-galactosyltransferase; AltName: Full=Fucosylglycoprotein alpha-N-acetylgalactosaminyltransferase; AltName: Full=Glycoprotein-fucosylgalactoside alpha-N-acetylgalactosaminyltransferase; AltName: Full=Glycoprotein-fucosylgalactoside alpha-galactosyltransferase; AltName: Full=Histo-blood group A transferase; Short=A transferase; AltName: Full=Histo-blood group B transferase; Short=B transferase; AltName: Full=NAGAT 2; AltName: Full=Putative blood group A transferase T2 [Rattus norvegicus] |
Related Sequences to LMP013649 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:237681192 | DBBJ | BAC16248.1 | 334 | histo-blood group ABO transferase [Rattus norvegicus] |
GI:237681192 | GenBank | AAO72725.1 | 334 | B blood group galactosyltransferase [Rattus norvegicus] |
GI:237681192 | GenBank | EDL93468.1 | 334 | rCG45409 [Rattus norvegicus] |
GI:237681192 | SwissProt | Q8CFC4.1 | 334 | RecName: Full=Histo-blood group ABO system transferase 2; AltName: Full=B blood group galactosyltransferase; AltName: Full=Blood group A glycosyltransferase 2; AltName: Full=Cis-AB transferase 2; AltName: Full=Fucosylglycoprotein 3-alpha-galactosyltransferase; AltName: Full=Fucosylglycoprotein alpha-N-acetylgalactosaminyltransferase; AltName: Full=Glycoprotein-fucosylgalactoside alpha-N-acetylgalactosaminyltransferase; AltName: Full=Glycoprotein-fucosylgalactoside alpha-galactosyltransferase; AltName: Full=Histo-blood group A transferase; Short=A transferase; AltName: Full=Histo-blood group B transferase; Short=B transferase; AltName: Full=NAGAT 2; AltName: Full=Putative blood group A transferase T2 [Rattus norvegicus] |