Gene/Proteome Database (LMPD)
Proteins
| serine palmitoyltransferase small subunit B | |
|---|---|
| Refseq ID | NP_001258228 |
| Protein GI | 404351658 |
| UniProt ID | D3ZG45 |
| mRNA ID | NM_001271299 |
| Length | 76 |
| MDFKRVKEYFAWLYYQYQIITCCAVMEPWEQSMLNTIILTIVAMVVYTAYVFIPIHIRLAWEFFSKICGYDSSISN | |
| serine palmitoyltransferase small subunit B | |
|---|---|
| Refseq ID | NP_001258230 |
| Protein GI | 404351662 |
| UniProt ID | D3ZG45 |
| mRNA ID | NM_001271301 |
| Length | 76 |
| Protein sequence is identical to GI:404351658 (mRNA isoform) | |
Gene Information
Entrez Gene ID
Gene Name
serine palmitoyltransferase, small subunit B
Gene Symbol
Species
Rattus norvegicus
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0017059 | IEA:Ensembl | C | serine C-palmitoyltransferase complex |
| GO:0004758 | IEA:Ensembl | F | serine C-palmitoyltransferase activity |
Domain Information
InterPro Annotations
| Accession | Description |
|---|---|
| IPR024512 | Small subunit of serine palmitoyltransferase-like |
UniProt Annotations
Entry Information
Gene Name
serine palmitoyltransferase, small subunit B
Protein Entry
D3ZG45_RAT
UniProt ID
Species
Rat
Identical and Related Proteins
Unique RefSeq proteins for LMP013652 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 404351658 | RefSeq | NP_001258228 | 76 | serine palmitoyltransferase small subunit B |
Identical Sequences to LMP013652 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:404351658 | GenBank | EDM00900.1 | 76 | rCG62702, isoform CRA_a [Rattus norvegicus] |
| GI:404351662 | GenBank | EDM00900.1 | 76 | rCG62702, isoform CRA_a [Rattus norvegicus] |
| GI:404351658 | GenBank | EDM00901.1 | 76 | rCG62702, isoform CRA_a [Rattus norvegicus] |
| GI:404351662 | GenBank | EDM00901.1 | 76 | rCG62702, isoform CRA_a [Rattus norvegicus] |
| GI:404351658 | RefSeq | NP_001157682.1 | 76 | serine palmitoyltransferase small subunit B isoform a [Mus musculus] |
| GI:404351662 | RefSeq | NP_001157682.1 | 76 | serine palmitoyltransferase small subunit B isoform a [Mus musculus] |
| GI:404351662 | RefSeq | NP_001258228.1 | 76 | serine palmitoyltransferase small subunit B [Rattus norvegicus] |
| GI:404351658 | RefSeq | NP_001258230.1 | 76 | serine palmitoyltransferase small subunit B [Rattus norvegicus] |
Related Sequences to LMP013652 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:404351662 | GenBank | AAH22628.1 | 76 | RIKEN cDNA 1110032A04 gene [Mus musculus] |
| GI:404351658 | GenBank | AAH22628.1 | 76 | RIKEN cDNA 1110032A04 gene [Mus musculus] |
| GI:404351662 | GenBank | EDM00900.1 | 76 | rCG62702, isoform CRA_a [Rattus norvegicus] |
| GI:404351658 | GenBank | EDM00900.1 | 76 | rCG62702, isoform CRA_a [Rattus norvegicus] |
| GI:404351658 | GenBank | EDM00901.1 | 76 | rCG62702, isoform CRA_a [Rattus norvegicus] |
| GI:404351662 | GenBank | EDM00901.1 | 76 | rCG62702, isoform CRA_a [Rattus norvegicus] |
| GI:404351658 | RefSeq | NP_598436.1 | 76 | serine palmitoyltransferase small subunit B isoform a [Mus musculus] |
| GI:404351662 | RefSeq | NP_598436.1 | 76 | serine palmitoyltransferase small subunit B isoform a [Mus musculus] |