Gene/Proteome Database (LMPD)

LMPD ID
LMP013658
Gene ID
Species
Macaca mulatta (Rhesus monkey)
Gene Name
alpha 1,4-galactosyltransferase
Gene Symbol
Alternate Names
alpha 1,4-galactosyltransferase;
Chromosome
10
Map Location
chromosome:10

Proteins

Refseq ID XP_001107622
Protein GI 109094415
UniProt ID F7FCK1
mRNA ID XM_002798377
Length 353
MSKPPDLLLRLLRGAPRQRVCALFIIGFKFTFFVSIMIYWHVVGEPKEQGQLYNLPADIPCPTLALPALPSHGPAPGNIFFLETSDRTNPNFLFMCSVESAARTHPESHVLVLMKGLPGGNASLPRHLGISLLSCFPNVQMLPLDLQELFRDTPLADWYAAVQGRWEPYLLPVLSDASRIALMWKFGGIYLDTDFIVLKNLRNLTNMLGTQSRYVLNGAFLAFERRHEFMALCMRDFVDHYNGWIWGHQGPQLLTRVFKKWCSIRSLAESHTCRGVTTLPPEAFYPIPWQDWKKYFEDINPEELPQLFNATYAVHVWNKKSQGTRFKATSRALLAQLHARYCPTTHKAMKMYL
Refseq ID XP_002798424
Protein GI 297261241
UniProt ID F7FCK1
mRNA ID XM_002798377
Length 353
Protein sequence is identical to GI:109094415 (mRNA isoform)
Refseq ID XP_002798423
Protein GI 297261239
UniProt ID F7FCK1
mRNA ID XM_002798377
Length 353
Protein sequence is identical to GI:109094415 (mRNA isoform)

Gene Information

Entrez Gene ID
Gene Name
alpha 1,4-galactosyltransferase
Gene Symbol
Species
Macaca mulatta

Gene Ontology (GO Annotations)

GO ID Source Type Description

KEGG Pathway Links

KEGG Pathway ID Description
ko00603 Glycosphingolipid biosynthesis - globo series
mcc00603 Glycosphingolipid biosynthesis - globo series
M00068 Glycosphingolipid biosynthesis, globo-series, LacCer => Gb4Cer
mcc_M00068 Glycosphingolipid biosynthesis, globo-series, LacCer => Gb4Cer
mcc01100 Metabolic pathways

Domain Information

InterPro Annotations

Accession Description
IPR007652 Alpha 1,4-glycosyltransferase domain
IPR007577 Glycosyltransferase, DXD sugar-binding motif
IPR029044 Nucleotide-diphospho-sugar transferases

UniProt Annotations

Entry Information

Gene Name
alpha 1,4-galactosyltransferase
Protein Entry
F7FCK1_MACMU
UniProt ID
Species
Rhesus monkey

Comments

Comment Type Description
Caution The sequence shown here is derived from an Ensembl automatic analysis pipeline and should be considered as preliminary data.
Caution The sequence shown here is derived from an Ensembl automatic analysis pipeline and should be considered as preliminary data. {ECO:0000313|Ensembl:ENSMMUP00000011847}.

Identical and Related Proteins

Unique RefSeq proteins for LMP013658 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
109094415 RefSeq XP_001107622 353 alpha 1,4-galactosyltransferase

Identical Sequences to LMP013658 proteins

Reference Database Accession Length Protein Name
GI:109094415 RefSeq XP_002798423.1 353 PREDICTED: lactosylceramide 4-alpha-galactosyltransferase isoform 2 [Macaca mulatta]
GI:109094415 RefSeq XP_002798424.1 353 PREDICTED: lactosylceramide 4-alpha-galactosyltransferase isoform 3 [Macaca mulatta]

Related Sequences to LMP013658 proteins

Reference Database Accession Length Protein Name
GI:109094415 GenBank AFH30547.1 353 lactosylceramide 4-alpha-galactosyltransferase [Macaca mulatta]
GI:109094415 RefSeq XP_005567148.1 353 PREDICTED: lactosylceramide 4-alpha-galactosyltransferase isoform X1 [Macaca fascicularis]