Gene/Proteome Database (LMPD)
Proteins
| Refseq ID | XP_001107622 |
| Protein GI | 109094415 |
| UniProt ID | F7FCK1 |
| mRNA ID | XM_002798377 |
| Length | 353 |
| MSKPPDLLLRLLRGAPRQRVCALFIIGFKFTFFVSIMIYWHVVGEPKEQGQLYNLPADIPCPTLALPALPSHGPAPGNIFFLETSDRTNPNFLFMCSVESAARTHPESHVLVLMKGLPGGNASLPRHLGISLLSCFPNVQMLPLDLQELFRDTPLADWYAAVQGRWEPYLLPVLSDASRIALMWKFGGIYLDTDFIVLKNLRNLTNMLGTQSRYVLNGAFLAFERRHEFMALCMRDFVDHYNGWIWGHQGPQLLTRVFKKWCSIRSLAESHTCRGVTTLPPEAFYPIPWQDWKKYFEDINPEELPQLFNATYAVHVWNKKSQGTRFKATSRALLAQLHARYCPTTHKAMKMYL | |
| Refseq ID | XP_002798424 |
| Protein GI | 297261241 |
| UniProt ID | F7FCK1 |
| mRNA ID | XM_002798377 |
| Length | 353 |
| Protein sequence is identical to GI:109094415 (mRNA isoform) | |
| Refseq ID | XP_002798423 |
| Protein GI | 297261239 |
| UniProt ID | F7FCK1 |
| mRNA ID | XM_002798377 |
| Length | 353 |
| Protein sequence is identical to GI:109094415 (mRNA isoform) | |
Gene Information
Entrez Gene ID
Gene Name
alpha 1,4-galactosyltransferase
Gene Symbol
Species
Macaca mulatta
Gene Ontology (GO Annotations)
KEGG Pathway Links
| KEGG Pathway ID | Description |
|---|---|
| ko00603 | Glycosphingolipid biosynthesis - globo series |
| mcc00603 | Glycosphingolipid biosynthesis - globo series |
| M00068 | Glycosphingolipid biosynthesis, globo-series, LacCer => Gb4Cer |
| mcc_M00068 | Glycosphingolipid biosynthesis, globo-series, LacCer => Gb4Cer |
| mcc01100 | Metabolic pathways |
Domain Information
UniProt Annotations
Entry Information
Gene Name
alpha 1,4-galactosyltransferase
Protein Entry
F7FCK1_MACMU
UniProt ID
Species
Rhesus monkey
Comments
| Comment Type | Description |
|---|---|
| Caution | The sequence shown here is derived from an Ensembl automatic analysis pipeline and should be considered as preliminary data. |
| Caution | The sequence shown here is derived from an Ensembl automatic analysis pipeline and should be considered as preliminary data. {ECO:0000313|Ensembl:ENSMMUP00000011847}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP013658 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 109094415 | RefSeq | XP_001107622 | 353 | alpha 1,4-galactosyltransferase |
Identical Sequences to LMP013658 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:109094415 | RefSeq | XP_002798423.1 | 353 | PREDICTED: lactosylceramide 4-alpha-galactosyltransferase isoform 2 [Macaca mulatta] |
| GI:109094415 | RefSeq | XP_002798424.1 | 353 | PREDICTED: lactosylceramide 4-alpha-galactosyltransferase isoform 3 [Macaca mulatta] |
Related Sequences to LMP013658 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:109094415 | GenBank | AFH30547.1 | 353 | lactosylceramide 4-alpha-galactosyltransferase [Macaca mulatta] |
| GI:109094415 | RefSeq | XP_005567148.1 | 353 | PREDICTED: lactosylceramide 4-alpha-galactosyltransferase isoform X1 [Macaca fascicularis] |