Gene/Proteome Database (LMPD)
Proteins
Refseq ID | XP_001087211 |
Protein GI | 109123094 |
UniProt ID | F6U4Z7 |
mRNA ID | XM_001087211 |
Length | 264 |
MPSIFAYQSSEVDWCESNFQYSELVAEFYNTFTNIPFFIFGPLMMLLMHPYAQKRSRYIYVFWVLFMIIGLFSMYFHMTLSFLGQLLDEIAILWLLGSGYSIWMPRCYFPSFLGGNRSQFIRLVFVTTVVSTPLSFLRPTVNAYVLNSIALHIVYIVCQEYRKTSNKELRHLIEVSVVLWAIALTSWISDRLLCNFWQRIHFFYLHSIWHVLISITFPYGMVTMALVDANYEMPGETLKVRYWPRDNWPVGLPYVEIRGDDKNC |
Gene Information
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0005783 | IEA:Ensembl | C | endoplasmic reticulum |
GO:0016021 | IEA:InterPro | C | integral component of membrane |
GO:0071633 | IEA:Ensembl | F | dihydroceramidase activity |
GO:0071277 | IEA:Ensembl | P | cellular response to calcium ion |
GO:0046514 | IEA:Ensembl | P | ceramide catabolic process |
GO:0030216 | IEA:Ensembl | P | keratinocyte differentiation |
GO:0019216 | IEA:Ensembl | P | regulation of lipid metabolic process |
GO:0010446 | IEA:Ensembl | P | response to alkaline pH |
GO:0046512 | IEA:Ensembl | P | sphingosine biosynthetic process |
KEGG Pathway Links
KEGG Pathway ID | Description |
---|---|
mcc01100 | Metabolic pathways |
ko00600 | Sphingolipid metabolism |
mcc00600 | Sphingolipid metabolism |
M00099 | Sphingosine biosynthesis |
mcc_M00099 | Sphingosine biosynthesis |
Domain Information
InterPro Annotations
Accession | Description |
---|---|
IPR008901 | Ceramidase |
UniProt Annotations
Entry Information
Identical and Related Proteins
Unique RefSeq proteins for LMP013697 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
109123094 | RefSeq | XP_001087211 | 264 | alkaline ceramidase 1 |
Identical Sequences to LMP013697 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:109123094 | GenBank | EHH29527.1 | 264 | Alkaline ceramidase 1 [Macaca mulatta] |
GI:109123094 | GenBank | EHH59108.1 | 264 | Alkaline ceramidase 1 [Macaca fascicularis] |
Related Sequences to LMP013697 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:109123094 | RefSeq | XP_003914798.1 | 264 | PREDICTED: alkaline ceramidase 1 [Papio anubis] |
GI:109123094 | RefSeq | XP_005587750.1 | 264 | PREDICTED: alkaline ceramidase 1 isoform X1 [Macaca fascicularis] |