Gene/Proteome Database (LMPD)

LMPD ID
LMP013697
Gene ID
Species
Macaca mulatta (Rhesus monkey)
Gene Name
alkaline ceramidase 1
Gene Symbol
Alternate Names
alkaline ceramidase 1;
Chromosome
19
Map Location
chromosome:19

Proteins

Refseq ID XP_001087211
Protein GI 109123094
UniProt ID F6U4Z7
mRNA ID XM_001087211
Length 264
MPSIFAYQSSEVDWCESNFQYSELVAEFYNTFTNIPFFIFGPLMMLLMHPYAQKRSRYIYVFWVLFMIIGLFSMYFHMTLSFLGQLLDEIAILWLLGSGYSIWMPRCYFPSFLGGNRSQFIRLVFVTTVVSTPLSFLRPTVNAYVLNSIALHIVYIVCQEYRKTSNKELRHLIEVSVVLWAIALTSWISDRLLCNFWQRIHFFYLHSIWHVLISITFPYGMVTMALVDANYEMPGETLKVRYWPRDNWPVGLPYVEIRGDDKNC

Gene Information

Entrez Gene ID
Gene Name
alkaline ceramidase 1
Gene Symbol
Species
Macaca mulatta

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005783 IEA:Ensembl C endoplasmic reticulum
GO:0016021 IEA:InterPro C integral component of membrane
GO:0071633 IEA:Ensembl F dihydroceramidase activity
GO:0071277 IEA:Ensembl P cellular response to calcium ion
GO:0046514 IEA:Ensembl P ceramide catabolic process
GO:0030216 IEA:Ensembl P keratinocyte differentiation
GO:0019216 IEA:Ensembl P regulation of lipid metabolic process
GO:0010446 IEA:Ensembl P response to alkaline pH
GO:0046512 IEA:Ensembl P sphingosine biosynthetic process

KEGG Pathway Links

KEGG Pathway ID Description
mcc01100 Metabolic pathways
ko00600 Sphingolipid metabolism
mcc00600 Sphingolipid metabolism
M00099 Sphingosine biosynthesis
mcc_M00099 Sphingosine biosynthesis

Domain Information

InterPro Annotations

Accession Description
IPR008901 Ceramidase

UniProt Annotations

Entry Information

Gene Name
alkaline ceramidase 1
Protein Entry
F6U4Z7_MACMU
UniProt ID
Species
Rhesus monkey

Identical and Related Proteins

Unique RefSeq proteins for LMP013697 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
109123094 RefSeq XP_001087211 264 alkaline ceramidase 1

Identical Sequences to LMP013697 proteins

Reference Database Accession Length Protein Name
GI:109123094 GenBank EHH29527.1 264 Alkaline ceramidase 1 [Macaca mulatta]
GI:109123094 GenBank EHH59108.1 264 Alkaline ceramidase 1 [Macaca fascicularis]

Related Sequences to LMP013697 proteins

Reference Database Accession Length Protein Name
GI:109123094 RefSeq XP_003914798.1 264 PREDICTED: alkaline ceramidase 1 [Papio anubis]
GI:109123094 RefSeq XP_005587750.1 264 PREDICTED: alkaline ceramidase 1 isoform X1 [Macaca fascicularis]