Gene/Proteome Database (LMPD)
LMPD ID
LMP013745
Gene ID
Species
Macaca mulatta (Rhesus monkey)
Gene Name
1-acylglycerol-3-phosphate O-acyltransferase 1 (lysophosphatidic acid acyltransferase, alpha)
Gene Symbol
Alternate Names
1-acyl-sn-glycerol-3-phosphate acyltransferase alpha;
Chromosome
4
Map Location
chromosome:4
Proteins
1-acyl-sn-glycerol-3-phosphate acyltransferase alpha | |
---|---|
Refseq ID | NP_001181575 |
Protein GI | 302564598 |
UniProt ID | F7HF22 |
mRNA ID | NM_001194646 |
Length | 283 |
Protein sequence is identical to GI:109070576 (mRNA isoform) |
Refseq ID | XP_001114553 |
Protein GI | 109070576 |
UniProt ID | F7HF22 |
mRNA ID | XM_001114674 |
Length | 283 |
MELWPGAWMLLLLLFLLLLFLLPTLWFCSPSAKYFFKMAFYNGWILFLAVLAIPVCAVRGRNVENMKILRLMLLHIKYLYGIRVEVRGAHHFPPSQPYVVVSNHQSSLDLLGMMEVLPGRCVPIAKRELLWAGSAGLACWLAGVIFIDRKRTGDAISVMSEVAQTLLTQDVRVWVFPEGTRNHNGSMLPFKRGAFHLAVQAQVPIVPIVMSSYQDFYCKKERRFTSGQCQVRVLPPVPTEGLTPDDVPALADRVRHSMLTVFREISTDGRGGGDYLKKPGGGG |
Refseq ID | XP_001114674 |
Protein GI | 109070586 |
UniProt ID | F7HF22 |
mRNA ID | XM_001114674 |
Length | 283 |
Protein sequence is identical to GI:109070576 (mRNA isoform) |
Refseq ID | XP_001114638 |
Protein GI | 109070584 |
UniProt ID | F7HF22 |
mRNA ID | XM_001114674 |
Length | 283 |
Protein sequence is identical to GI:109070576 (mRNA isoform) |
Refseq ID | XP_001114591 |
Protein GI | 109070580 |
UniProt ID | F7HF22 |
mRNA ID | XM_001114674 |
Length | 283 |
Protein sequence is identical to GI:109070576 (mRNA isoform) |
Gene Information
Entrez Gene ID
Gene Name
1-acylglycerol-3-phosphate O-acyltransferase 1 (lysophosphatidic acid acyltransferase, alpha)
Gene Symbol
Species
Macaca mulatta
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0016020 | IEA:InterPro | C | membrane |
GO:0003841 | IEA:Ensembl | F | 1-acylglycerol-3-phosphate O-acyltransferase activity |
GO:0006654 | IEA:Ensembl | P | phosphatidic acid biosynthetic process |
GO:0001819 | IEA:Ensembl | P | positive regulation of cytokine production |
KEGG Pathway Links
KEGG Pathway ID | Description |
---|---|
ko04975 | Fat digestion and absorption |
mcc04975 | Fat digestion and absorption |
ko00561 | Glycerolipid metabolism |
mcc00561 | Glycerolipid metabolism |
ko00564 | Glycerophospholipid metabolism |
mcc00564 | Glycerophospholipid metabolism |
mcc01100 | Metabolic pathways |
M00089 | Triacylglycerol biosynthesis |
mcc_M00089 | Triacylglycerol biosynthesis |
Domain Information
UniProt Annotations
Entry Information
Gene Name
1-acylglycerol-3-phosphate O-acyltransferase 1 (lysophosphatidic acid acyltransferase, alpha)
Protein Entry
F7HF22_MACMU
UniProt ID
Species
Rhesus monkey
Identical and Related Proteins
Unique RefSeq proteins for LMP013745 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
109070576 | RefSeq | XP_001114553 | 283 | 1-acylglycerol-3-phosphate O-acyltransferase 1 (lysophosphatidic acid acyltransferase, alpha) |
Identical Sequences to LMP013745 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:302564598 | RefSeq | XP_005553478.1 | 283 | PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase alpha isoform X3 [Macaca fascicularis] |
GI:302564598 | RefSeq | XP_005553479.1 | 283 | PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase alpha isoform X4 [Macaca fascicularis] |
GI:302564598 | RefSeq | XP_005553480.1 | 283 | PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase alpha isoform X5 [Macaca fascicularis] |
GI:302564598 | RefSeq | XP_010376494.1 | 283 | PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase alpha isoform X2 [Rhinopithecus roxellana] |
Related Sequences to LMP013745 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:302564598 | GenBank | EHH18199.1 | 283 | 1-acyl-sn-glycerol-3-phosphate acyltransferase alpha [Macaca mulatta] |
GI:302564598 | RefSeq | XP_001114553.1 | 283 | PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase alpha-like isoform 3 [Macaca mulatta] |
GI:302564598 | RefSeq | XP_001114638.1 | 283 | PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase alpha-like isoform 7 [Macaca mulatta] |
GI:302564598 | RefSeq | XP_001114674.1 | 283 | PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase alpha-like isoform 9 [Macaca mulatta] |