Gene/Proteome Database (LMPD)
LMPD ID
LMP013775
Gene ID
Species
Macaca mulatta (Rhesus monkey)
Gene Name
asparagine-linked glycosylation 5, dolichyl-phosphate beta-glucosyltransferase homolog (S. cerevisiae)
Gene Symbol
Alternate Names
dolichyl-phosphate beta-glucosyltransferase;
Chromosome
17
Map Location
chromosome:17
Proteins
| dolichyl-phosphate beta-glucosyltransferase | |
|---|---|
| Refseq ID | NP_001244797 |
| Protein GI | 383872398 |
| UniProt ID | F7EN62 |
| mRNA ID | NM_001257868 |
| Length | 324 |
| Protein sequence is identical to GI:109120490 (mRNA isoform) | |
| Refseq ID | XP_001084873 |
| Protein GI | 109120490 |
| UniProt ID | F7EN62 |
| mRNA ID | XM_001084873 |
| Length | 324 |
| MAPLLLQLAVLGAALAAAALVLISVVAFITATKMPALHRHEEEKFFLNAKGQKETLPSIWDLPTKQLSVVVPSYNEEKRLPVMMDEALSYLEKRQKRDPAFTYEVIVVDDGSKDKTSKVAFKYCQKYGSDKVRVITLVKNRGKGGAIRMGIFSSRGEKILMADADGATKFPDVEKLEKGLNDLQPWPNQMAIACGSRAHLEKESIAQRSYFRTLLMYGFHFLVWFLCVKGIRDTQCGFKLFTREAASQTFSSLHVERWAFDVELLYIAQCFKIPIAEIAVNWTEIEGSKLVPFWSWLQMGKDLLFIRLRYMTGAWRLEQTRKMN | |
| Refseq ID | XP_002800768 |
| Protein GI | 297274285 |
| UniProt ID | F7EN62 |
| mRNA ID | XM_001084873 |
| Length | 294 |
| MAPLLLQLAVLGAALAAAALVLISVVAFITATKMPALHRHEEEKFFLNAKGQKETLPSIWDLPTKQLSVVVPSYNEEKRLPVMMDEALSYLEKRQKYGSDKVRVITLVKNRGKGGAIRMGIFSSRGEKILMADADGATKFPDVEKLEKGLNDLQPWPNQMAIACGSRAHLEKESIAQRSYFRTLLMYGFHFLVWFLCVKGIRDTQCGFKLFTREAASQTFSSLHVERWAFDVELLYIAQCFKIPIAEIAVNWTEIEGSKLVPFWSWLQMGKDLLFIRLRYMTGAWRLEQTRKMN | |
Gene Information
Entrez Gene ID
Gene Name
asparagine-linked glycosylation 5, dolichyl-phosphate beta-glucosyltransferase homolog (S. cerevisiae)
Gene Symbol
Species
Macaca mulatta
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0016020 | IEA:Ensembl | C | membrane |
| GO:0016757 | IEA:UniProtKB-KW | F | transferase activity, transferring glycosyl groups |
| GO:0007368 | IEA:Ensembl | P | determination of left/right symmetry |
KEGG Pathway Links
| KEGG Pathway ID | Description |
|---|---|
| mcc01100 | Metabolic pathways |
| ko00510 | N-Glycan biosynthesis |
| mcc00510 | N-Glycan biosynthesis |
| M00055 | N-glycan precursor biosynthesis |
| mcc_M00055 | N-glycan precursor biosynthesis |
Domain Information
UniProt Annotations
Entry Information
Gene Name
asparagine-linked glycosylation 5, dolichyl-phosphate beta-glucosyltransferase homolog (S. cerevisiae)
Protein Entry
F7EN62_MACMU
UniProt ID
Species
Rhesus monkey
Identical and Related Proteins
Unique RefSeq proteins for LMP013775 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 109120490 | RefSeq | XP_001084873 | 324 | asparagine-linked glycosylation 5, dolichyl-phosphate beta-glucosyltransferase homolog (S. cerevisiae) |
| 297274285 | RefSeq | XP_002800768 | 294 | asparagine-linked glycosylation 5, dolichyl-phosphate beta-glucosyltransferase homolog (S. cerevisiae) |
Identical Sequences to LMP013775 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:383872398 | GenBank | EHH28955.1 | 324 | Dolichyl-phosphate beta-glucosyltransferase [Macaca mulatta] |
| GI:383872398 | GenBank | EHH58537.1 | 324 | Dolichyl-phosphate beta-glucosyltransferase [Macaca fascicularis] |
| GI:383872398 | GenBank | AFE66365.1 | 324 | dolichyl-phosphate beta-glucosyltransferase isoform 1 [Macaca mulatta] |
| GI:383872398 | RefSeq | XP_005585733.1 | 324 | PREDICTED: dolichyl-phosphate beta-glucosyltransferase isoform X1 [Macaca fascicularis] |
Related Sequences to LMP013775 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|