Gene/Proteome Database (LMPD)

LMPD ID
LMP013796
Gene ID
Species
Macaca mulatta (Rhesus monkey)
Gene Name
annexin A9
Gene Symbol
Alternate Names
annexin A9;
Chromosome
1
Map Location
chromosome:1

Proteins

Refseq ID XP_001103401
Protein GI 109016100
UniProt ID F7E6S3
mRNA ID XM_001103401
Length 345
MSASGGKMGPSLTQEILSHLGLASKTAAWGTLGTLRTFLNFSVDKDAQRLLRAITGQGVDRSAIVDVLTNRSREQRQLISRAFQERTQQDLLKSLRAALSGNLERIVMALLQPAARFDAQELRTALKASDSAVDVAIEILATRTPPRLQECLAVYKHDFQVEAVDDITSQTNGILRDLLLALVKGGRDSYSGIIDYNLAEQDVRALQRAEGPSTEETWVPLLTQRNPEHLIRVFDQYQRSTGQELEEAVQNRFHGDAQAALLGLASVIKNTPLYFADKLHQALQETEPNYQVLIRILISRCETDLLSIRAEFKKKFGKSLYSSLQDAVKGDCQSALLALCRAEDM

Gene Information

Entrez Gene ID
Gene Name
annexin A9
Gene Symbol
Species
Macaca mulatta

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0009986 IEA:Ensembl C cell surface
GO:0005829 IEA:Ensembl C cytosol
GO:0070062 IEA:Ensembl C extracellular vesicular exosome
GO:0015464 IEA:Ensembl F acetylcholine receptor activity
GO:0005509 IEA:InterPro F calcium ion binding
GO:0005544 IEA:UniProtKB-KW F calcium-dependent phospholipid binding
GO:0001786 IEA:Ensembl F phosphatidylserine binding
GO:0016337 IEA:Ensembl P single organismal cell-cell adhesion

Domain Information

InterPro Annotations

Accession Description
IPR001464 Annexin
IPR018252 Annexin repeat, conserved site
IPR009116 Annexin, type XXXI
IPR018502 Annexin_repeat

UniProt Annotations

Entry Information

Gene Name
annexin A9
Protein Entry
F7E6S3_MACMU
UniProt ID
Species
Rhesus monkey

Comments

Comment Type Description
Caution The sequence shown here is derived from an Ensembl automatic analysis pipeline and should be considered as preliminary data.
Domain A pair of annexin repeats may form one binding site for calcium and phospholipid.
Similarity Belongs to the annexin family.
Similarity Contains 4 annexin repeats.
Similarity Contains annexin repeats.

Identical and Related Proteins

Unique RefSeq proteins for LMP013796 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
109016100 RefSeq XP_001103401 345 annexin A9

Identical Sequences to LMP013796 proteins

Reference Database Accession Length Protein Name
GI:109016100 GenBank EHH62652.1 345 hypothetical protein EGM_21042 [Macaca fascicularis]

Related Sequences to LMP013796 proteins

Reference Database Accession Length Protein Name
GI:109016100 GenBank EHH15184.1 345 hypothetical protein EGK_01242 [Macaca mulatta]
GI:109016100 RefSeq XP_003892649.1 345 PREDICTED: annexin A9 [Papio anubis]
GI:109016100 RefSeq XP_005542011.1 345 PREDICTED: annexin A9 [Macaca fascicularis]