Gene/Proteome Database (LMPD)
Proteins
Refseq ID | XP_001103401 |
Protein GI | 109016100 |
UniProt ID | F7E6S3 |
mRNA ID | XM_001103401 |
Length | 345 |
MSASGGKMGPSLTQEILSHLGLASKTAAWGTLGTLRTFLNFSVDKDAQRLLRAITGQGVDRSAIVDVLTNRSREQRQLISRAFQERTQQDLLKSLRAALSGNLERIVMALLQPAARFDAQELRTALKASDSAVDVAIEILATRTPPRLQECLAVYKHDFQVEAVDDITSQTNGILRDLLLALVKGGRDSYSGIIDYNLAEQDVRALQRAEGPSTEETWVPLLTQRNPEHLIRVFDQYQRSTGQELEEAVQNRFHGDAQAALLGLASVIKNTPLYFADKLHQALQETEPNYQVLIRILISRCETDLLSIRAEFKKKFGKSLYSSLQDAVKGDCQSALLALCRAEDM |
Gene Information
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0009986 | IEA:Ensembl | C | cell surface |
GO:0005829 | IEA:Ensembl | C | cytosol |
GO:0070062 | IEA:Ensembl | C | extracellular vesicular exosome |
GO:0015464 | IEA:Ensembl | F | acetylcholine receptor activity |
GO:0005509 | IEA:InterPro | F | calcium ion binding |
GO:0005544 | IEA:UniProtKB-KW | F | calcium-dependent phospholipid binding |
GO:0001786 | IEA:Ensembl | F | phosphatidylserine binding |
GO:0016337 | IEA:Ensembl | P | single organismal cell-cell adhesion |
Domain Information
UniProt Annotations
Entry Information
Comments
Comment Type | Description |
---|---|
Caution | The sequence shown here is derived from an Ensembl automatic analysis pipeline and should be considered as preliminary data. |
Domain | A pair of annexin repeats may form one binding site for calcium and phospholipid. |
Similarity | Belongs to the annexin family. |
Similarity | Contains 4 annexin repeats. |
Similarity | Contains annexin repeats. |
Identical and Related Proteins
Unique RefSeq proteins for LMP013796 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
109016100 | RefSeq | XP_001103401 | 345 | annexin A9 |
Identical Sequences to LMP013796 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:109016100 | GenBank | EHH62652.1 | 345 | hypothetical protein EGM_21042 [Macaca fascicularis] |
Related Sequences to LMP013796 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:109016100 | GenBank | EHH15184.1 | 345 | hypothetical protein EGK_01242 [Macaca mulatta] |
GI:109016100 | RefSeq | XP_003892649.1 | 345 | PREDICTED: annexin A9 [Papio anubis] |
GI:109016100 | RefSeq | XP_005542011.1 | 345 | PREDICTED: annexin A9 [Macaca fascicularis] |