Gene/Proteome Database (LMPD)
Proteins
| Refseq ID | XP_001112583 |
| Protein GI | 109095449 |
| UniProt ID | F7FTF0 |
| mRNA ID | XM_001112583 |
| Length | 236 |
| MTSEKGPSTGDPTLRRRIEPWEFDIFYDPRELRKEACLLYEIKWGMSPKIWRSSGKNTTNHVEVNFIEKLTSERRFHSSISCSITWFLSWSPCWECSQAIREFLSQHPGVTLVIYVARLFWHTDQQNRQGLRDLVNSGVTIQIMRASEYYHCWRNFVNYPPGEEAHWPRYPPLWMMLYALELHCIILSLPPCLKISRRWQNHLTFFRLHLQNCHYQMIPPHILLATGLIQPSVTWR | |
Gene Information
Entrez Gene ID
Gene Name
apolipoprotein B mRNA editing enzyme, catalytic polypeptide 1
Gene Symbol
Species
Macaca mulatta
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005737 | IEA:Ensembl | C | cytoplasm |
| GO:0017091 | IEA:Ensembl | F | AU-rich element binding |
| GO:0016814 | IEA:InterPro | F | hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in cyclic amidines |
| GO:0008270 | IEA:InterPro | F | zinc ion binding |
| GO:0080111 | IEA:Ensembl | P | DNA demethylation |
| GO:0016554 | IEA:Ensembl | P | cytidine to uridine editing |
| GO:0042158 | IEA:Ensembl | P | lipoprotein biosynthetic process |
| GO:0042953 | IEA:Ensembl | P | lipoprotein transport |
| GO:0016556 | IEA:Ensembl | P | mRNA modification |
| GO:0048255 | IEA:Ensembl | P | mRNA stabilization |
| GO:0090310 | IEA:Ensembl | P | negative regulation of methylation-dependent chromatin silencing |
| GO:0042127 | IEA:Ensembl | P | regulation of cell proliferation |
| GO:0010332 | IEA:Ensembl | P | response to gamma radiation |
Domain Information
UniProt Annotations
Entry Information
Gene Name
apolipoprotein B mRNA editing enzyme, catalytic polypeptide 1
Protein Entry
F7FTF0_MACMU
UniProt ID
Species
Rhesus monkey
Identical and Related Proteins
Unique RefSeq proteins for LMP013809 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 109095449 | RefSeq | XP_001112583 | 236 | apolipoprotein B mRNA editing enzyme, catalytic polypeptide 1 |
Identical Sequences to LMP013809 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|
Related Sequences to LMP013809 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:109095449 | GenBank | EHH20457.1 | 231 | C->U-editing enzyme APOBEC-1, partial [Macaca mulatta] |
| GI:109095449 | GenBank | EHH62261.1 | 231 | C->U-editing enzyme APOBEC-1, partial [Macaca fascicularis] |
| GI:109095449 | RefSeq | XP_005570077.1 | 248 | PREDICTED: c->U-editing enzyme APOBEC-1 [Macaca fascicularis] |
| GI:109095449 | RefSeq | XP_003905967.2 | 248 | PREDICTED: C->U-editing enzyme APOBEC-1 [Papio anubis] |