Gene/Proteome Database (LMPD)

LMPD ID
LMP013809
Gene ID
Species
Macaca mulatta (Rhesus monkey)
Gene Name
apolipoprotein B mRNA editing enzyme, catalytic polypeptide 1
Gene Symbol
Alternate Names
apolipoprotein B mRNA editing enzyme, catalytic polypeptide 1;
Chromosome
11
Map Location
chromosome:11

Proteins

Refseq ID XP_001112583
Protein GI 109095449
UniProt ID F7FTF0
mRNA ID XM_001112583
Length 236
MTSEKGPSTGDPTLRRRIEPWEFDIFYDPRELRKEACLLYEIKWGMSPKIWRSSGKNTTNHVEVNFIEKLTSERRFHSSISCSITWFLSWSPCWECSQAIREFLSQHPGVTLVIYVARLFWHTDQQNRQGLRDLVNSGVTIQIMRASEYYHCWRNFVNYPPGEEAHWPRYPPLWMMLYALELHCIILSLPPCLKISRRWQNHLTFFRLHLQNCHYQMIPPHILLATGLIQPSVTWR

Gene Information

Entrez Gene ID
Gene Name
apolipoprotein B mRNA editing enzyme, catalytic polypeptide 1
Gene Symbol
Species
Macaca mulatta

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005737 IEA:Ensembl C cytoplasm
GO:0017091 IEA:Ensembl F AU-rich element binding
GO:0016814 IEA:InterPro F hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in cyclic amidines
GO:0008270 IEA:InterPro F zinc ion binding
GO:0080111 IEA:Ensembl P DNA demethylation
GO:0016554 IEA:Ensembl P cytidine to uridine editing
GO:0042158 IEA:Ensembl P lipoprotein biosynthetic process
GO:0042953 IEA:Ensembl P lipoprotein transport
GO:0016556 IEA:Ensembl P mRNA modification
GO:0048255 IEA:Ensembl P mRNA stabilization
GO:0090310 IEA:Ensembl P negative regulation of methylation-dependent chromatin silencing
GO:0042127 IEA:Ensembl P regulation of cell proliferation
GO:0010332 IEA:Ensembl P response to gamma radiation

Domain Information

InterPro Annotations

Accession Description
IPR013158 APOBEC-like, N-terminal
IPR016192 APOBEC/CMP deaminase, zinc-binding
IPR016193 Cytidine_deaminase-like

UniProt Annotations

Entry Information

Gene Name
apolipoprotein B mRNA editing enzyme, catalytic polypeptide 1
Protein Entry
F7FTF0_MACMU
UniProt ID
Species
Rhesus monkey

Identical and Related Proteins

Unique RefSeq proteins for LMP013809 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
109095449 RefSeq XP_001112583 236 apolipoprotein B mRNA editing enzyme, catalytic polypeptide 1

Identical Sequences to LMP013809 proteins

Reference Database Accession Length Protein Name

Related Sequences to LMP013809 proteins

Reference Database Accession Length Protein Name
GI:109095449 GenBank EHH20457.1 231 C->U-editing enzyme APOBEC-1, partial [Macaca mulatta]
GI:109095449 GenBank EHH62261.1 231 C->U-editing enzyme APOBEC-1, partial [Macaca fascicularis]
GI:109095449 RefSeq XP_005570077.1 248 PREDICTED: c->U-editing enzyme APOBEC-1 [Macaca fascicularis]
GI:109095449 RefSeq XP_003905967.2 248 PREDICTED: C->U-editing enzyme APOBEC-1 [Papio anubis]