Gene/Proteome Database (LMPD)
Proteins
Refseq ID | XP_001090312 |
Protein GI | 109108764 |
UniProt ID | F7FQN1 |
mRNA ID | XM_001090312 |
Length | 99 |
MQPRVLLVAALLSLLASARASEAEDTSLLGFMQDYMQHATKTAKDALTSVQESQVAQQARGWVTDGFSSLKDYWSTVKDKLSGFWDLNPEAKPTLAEAA |
Gene Information
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0042627 | IEA:Ensembl | C | chylomicron |
GO:0070062 | IEA:Ensembl | C | extracellular vesicular exosome |
GO:0034363 | IEA:Ensembl | C | intermediate-density lipoprotein particle |
GO:0034366 | IEA:Ensembl | C | spherical high-density lipoprotein particle |
GO:0034361 | IEA:Ensembl | C | very-low-density lipoprotein particle |
GO:0055102 | IEA:Ensembl | F | lipase inhibitor activity |
GO:0005543 | IEA:Ensembl | F | phospholipid binding |
GO:0033344 | IEA:Ensembl | P | cholesterol efflux |
GO:0042632 | IEA:Ensembl | P | cholesterol homeostasis |
GO:0008203 | IEA:Ensembl | P | cholesterol metabolic process |
GO:0034382 | IEA:Ensembl | P | chylomicron remnant clearance |
GO:0007186 | IEA:Ensembl | P | G-protein coupled receptor signaling pathway |
GO:0034375 | IEA:Ensembl | P | high-density lipoprotein particle remodeling |
GO:0042157 | IEA:InterPro | P | lipoprotein metabolic process |
GO:0060621 | IEA:Ensembl | P | negative regulation of cholesterol import |
GO:0045717 | IEA:Ensembl | P | negative regulation of fatty acid biosynthetic process |
GO:0010987 | IEA:Ensembl | P | negative regulation of high-density lipoprotein particle clearance |
GO:0051005 | IEA:Ensembl | P | negative regulation of lipoprotein lipase activity |
GO:0010989 | IEA:Ensembl | P | negative regulation of low-density lipoprotein particle clearance |
GO:0048261 | IEA:Ensembl | P | negative regulation of receptor-mediated endocytosis |
GO:0010897 | IEA:Ensembl | P | negative regulation of triglyceride catabolic process |
GO:0010916 | IEA:Ensembl | P | negative regulation of very-low-density lipoprotein particle clearance |
GO:0033700 | IEA:Ensembl | P | phospholipid efflux |
GO:0032489 | IEA:Ensembl | P | regulation of Cdc42 protein signal transduction |
GO:0019433 | IEA:Ensembl | P | triglyceride catabolic process |
GO:0070328 | IEA:Ensembl | P | triglyceride homeostasis |
GO:0006642 | IEA:Ensembl | P | triglyceride mobilization |
KEGG Pathway Links
Domain Information
InterPro Annotations
Accession | Description |
---|---|
IPR008403 | Apolipoprotein CIII |
UniProt Annotations
Entry Information
Identical and Related Proteins
Unique RefSeq proteins for LMP013813 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
109108764 | RefSeq | XP_001090312 | 99 | apolipoprotein C-III |
Identical Sequences to LMP013813 proteins
Reference | Database | Accession | Length | Protein Name |
---|
Related Sequences to LMP013813 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:109108764 | EMBL | CAA48419.1 | 99 | apolipoprotein C-III [Macaca fascicularis] |
GI:109108764 | GenBank | AGU37455.1 | 99 | Sequence 6 from patent US 8507444 |
GI:109108764 | GenBank | AGY24867.1 | 99 | Sequence 6 from patent US 8557513 |
GI:109108764 | SwissProt | P18659.2 | 99 | RecName: Full=Apolipoprotein C-III; Short=Apo-CIII; Short=ApoC-III; AltName: Full=Apolipoprotein C3; Flags: Precursor [Macaca fascicularis] |