Gene/Proteome Database (LMPD)

LMPD ID
LMP013814
Gene ID
714623
Species
Macaca mulatta (Rhesus monkey)
Gene Name
apolipoprotein E
Gene Symbol
APOE
Synonyms
Apo-E;
Alternate Names
apolipoprotein E;
Chromosome
19
Map Location
chromosome:19

Proteins

Refseq ID XP_001104482
Protein GI 297277315
mRNA ID XM_001104482
Length 263
MKVLWAALLVTFLAGCQAKVEQPVEPETEPELRQQAEGQSGQPWELALGRFWDYLRWVQTLSEQVQEELLSPQVTQELTTLMDETMKELKAYKSELEEQLSPVAEETRARLSKELQAAQARLGADMEDVRSRLVQYRSEVQAMLGQSTEELRARLASHLRKLRKRLLRDADDLQKRLAVYQAGAREGAERGVSAIRERLGPLVEQGRVRAATVGSLASQPLQERAQALGERLRARMEEMGSRTRDRLDEVKEQVAESAPPAPP

Gene Information

Entrez Gene ID
714623
Gene Name
apolipoprotein E
Gene Symbol
APOE
Species
Macaca mulatta

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0072562 IEA:Ensembl C blood microparticle
GO:0042627 IEA:UniProtKB-KW C chylomicron
GO:0070062 IEA:Ensembl C extracellular vesicular exosome
GO:0034364 IEA:UniProtKB-KW C high-density lipoprotein particle
GO:0034363 IEA:Ensembl C intermediate-density lipoprotein particle
GO:0005634 IEA:Ensembl C nucleus
GO:0034361 IEA:UniProtKB-KW C very-low-density lipoprotein particle
GO:0016209 IEA:Ensembl F antioxidant activity
GO:0001540 IEA:Ensembl F beta-amyloid binding
GO:0017127 IEA:Ensembl F cholesterol transporter activity
GO:0008201 IEA:UniProtKB-KW F heparin binding
GO:0008289 IEA:Ensembl F lipid binding
GO:0071813 IEA:Ensembl F lipoprotein particle binding
GO:0046911 IEA:Ensembl F metal chelating activity
GO:0097113 IEA:Ensembl P alpha-amino-3-hydroxy-5-methyl-4-isoxazole propionate selective glutamate receptor clustering
GO:0048844 IEA:Ensembl P artery morphogenesis
GO:0006874 IEA:Ensembl P cellular calcium ion homeostasis
GO:0019934 IEA:Ensembl P cGMP-mediated signaling
GO:0006707 IEA:Ensembl P cholesterol catabolic process
GO:0033344 IEA:Ensembl P cholesterol efflux
GO:0042632 IEA:Ensembl P cholesterol homeostasis
GO:0034382 IEA:Ensembl P chylomicron remnant clearance
GO:0055089 IEA:Ensembl P fatty acid homeostasis
GO:0007186 IEA:Ensembl P G-protein coupled receptor signaling pathway
GO:0034380 IEA:Ensembl P high-density lipoprotein particle assembly
GO:0034384 IEA:Ensembl P high-density lipoprotein particle clearance
GO:0034375 IEA:Ensembl P high-density lipoprotein particle remodeling
GO:0042158 IEA:Ensembl P lipoprotein biosynthetic process
GO:0042159 IEA:Ensembl P lipoprotein catabolic process
GO:0015909 IEA:Ensembl P long-chain fatty acid transport
GO:0034374 IEA:Ensembl P low-density lipoprotein particle remodeling
GO:0051651 IEA:Ensembl P maintenance of location in cell
GO:1902430 IEA:Ensembl P negative regulation of beta-amyloid formation
GO:0043537 IEA:Ensembl P negative regulation of blood vessel endothelial cell migration
GO:0045541 IEA:Ensembl P negative regulation of cholesterol biosynthetic process
GO:0090370 IEA:Ensembl P negative regulation of cholesterol efflux
GO:0061000 IEA:Ensembl P negative regulation of dendritic spine development
GO:1902951 IEA:Ensembl P negative regulation of dendritic spine maintenance
GO:0001937 IEA:Ensembl P negative regulation of endothelial cell proliferation
GO:0050728 IEA:Ensembl P negative regulation of inflammatory response
GO:1903001 IEA:Ensembl P negative regulation of lipid transport across blood brain barrier
GO:0043407 IEA:Ensembl P negative regulation of MAP kinase activity
GO:1901215 IEA:Ensembl P negative regulation of neuron death
GO:1902999 IEA:Ensembl P negative regulation of phospholipid efflux
GO:0010544 IEA:Ensembl P negative regulation of platelet activation
GO:1901627 IEA:Ensembl P negative regulation of postsynaptic membrane organization
GO:1901630 IEA:Ensembl P negative regulation of presynaptic membrane organization
GO:0007263 IEA:Ensembl P nitric oxide mediated signal transduction
GO:0097114 IEA:Ensembl P N-methyl-D-aspartate receptor clustering
GO:0033700 IEA:Ensembl P phospholipid efflux
GO:1902004 IEA:Ensembl P positive regulation of beta-amyloid formation
GO:0030828 IEA:Ensembl P positive regulation of cGMP biosynthetic process
GO:0010875 IEA:Ensembl P positive regulation of cholesterol efflux
GO:0060999 IEA:Ensembl P positive regulation of dendritic spine development
GO:1902952 IEA:Ensembl P positive regulation of dendritic spine maintenance
GO:0046889 IEA:Ensembl P positive regulation of lipid biosynthetic process
GO:1903002 IEA:Ensembl P positive regulation of lipid transport across blood brain barrier
GO:0032805 IEA:Ensembl P positive regulation of low-density lipoprotein particle receptor catabolic process
GO:0051044 IEA:Ensembl P positive regulation of membrane protein ectodomain proteolysis
GO:1902998 IEA:Ensembl P positive regulation of neurofibrillary tangle assembly
GO:1901216 IEA:Ensembl P positive regulation of neuron death
GO:0051000 IEA:Ensembl P positive regulation of nitric-oxide synthase activity
GO:1902995 IEA:Ensembl P positive regulation of phospholipid efflux
GO:1901628 IEA:Ensembl P positive regulation of postsynaptic membrane organization
GO:1901631 IEA:Ensembl P positive regulation of presynaptic membrane organization
GO:0017038 IEA:Ensembl P protein import
GO:0006898 IEA:Ensembl P receptor-mediated endocytosis
GO:1900221 IEA:Ensembl P regulation of beta-amyloid clearance
GO:0032489 IEA:Ensembl P regulation of Cdc42 protein signal transduction
GO:1902947 IEA:Ensembl P regulation of tau-protein kinase activity
GO:0002021 IEA:Ensembl P response to dietary excess
GO:0006979 IEA:Ensembl P response to oxidative stress
GO:0043691 IEA:Ensembl P reverse cholesterol transport
GO:0006641 IEA:Ensembl P triglyceride metabolic process
GO:0042311 IEA:Ensembl P vasodilation
GO:0034447 IEA:Ensembl P very-low-density lipoprotein particle clearance

KEGG Pathway Links

KEGG Pathway ID Description
ko05010 Alzheimer's disease
mcc05010 Alzheimer's disease

Domain Information

InterPro Annotations

Accession Description
IPR000074 Apolipoprotein A/E

UniProt Annotations

Entry Information

Gene Name
apolipoprotein E
Species
Rhesus monkey

Comments

Comment Type Description
Function Mediates the binding, internalization, and catabolism of lipoprotein particles. It can serve as a ligand for the LDL (apo B/E) receptor and for the specific apo-E receptor (chylomicron remnant) of hepatic tissues.
Ptm Phosphorylation sites are present in the extracellular medium. {ECO:0000250}.
Similarity Belongs to the apolipoprotein A1/A4/E family. {ECO:0000305}.
Subcellular Location Secreted.
Tissue Specificity Secreted in plasma.

Identical and Related Proteins

Unique RefSeq proteins for LMP013814 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
297277315 RefSeq XP_001104482 263

Identical Sequences to LMP013814 proteins

Reference Database Accession Length Protein Name

Related Sequences to LMP013814 proteins

Reference Database Accession Length Protein Name
GI:297277315 EMBL CAA32092.1 317 proapolipoprotein E (AA -18 to 299) [Macaca fascicularis]
GI:297277315 GenBank AFJ72052.1 317 apolipoprotein E precursor [Macaca mulatta]
GI:297277315 RefSeq XP_005589610.1 317 PREDICTED: apolipoprotein E isoform X1 [Macaca fascicularis]
GI:297277315 SwissProt P10517.1 317 RecName: Full=Apolipoprotein E; Short=Apo-E; Flags: Precursor [Macaca fascicularis]