Gene/Proteome Database (LMPD)
Proteins
Refseq ID | XP_001098342 |
Protein GI | 109085733 |
UniProt ID | F6S5C7 |
mRNA ID | XM_001098342 |
Length | 395 |
MLGRSRLSLVLLAAAVSCAVAQHAPPWTEDCRKSTYPPSGPTYRGPAPWYTINLDLPPYKRWHELMADKAPMLKVIVNSLKNMVNTFVPSGKVMQIVDEKLPGLLGNFPGPFEEEMKGIAAVTDIPLGEIISYNIFYEFFTLCTSIVAEDKKGHLIHGRNMDFGVFLGWNINNDTWVITEELKPLTVNLDFQRNNKTVFKASSFAGYVGMLTGFKPGLFSLTLNERFSVNGGYLGILEWILGKKDAMWIGFLTRTVLENSTSYEEAKNILTKTKILAPAYFILGGNQSGEGCVITRDRKESLDVYELDAKQGRWYVVQTNYDRWKNPFFLDDRRTPAKMCLNRTTQENISFENMYDVLSTKPVLNKLTVFTTLIDVTKDQFETYMRDCPDPCIGW |
Refseq ID | XP_001098236 |
Protein GI | 109085735 |
UniProt ID | F6S5F3 |
mRNA ID | XM_001098342 |
Length | 411 |
MNGRVWLGDKARGSHLASSPSLSALFTEASILGFGSSAVKAQWTEDCRKSTYPPSGPTYRGPAPWYTINLDLPPYKRWHELMADKAPMLKVIVNSLKNMVNTFVPSGKVMQIVDEKLPGLLGNFPGPFEEEMKGIAAVTDIPLGEIISYNIFYEFFTLCTSIVAEDKKGHLIHGRNMDFGVFLGWNINNDTWVITEELKPLTVNLDFQRNNKTVFKASSFAGYVGMLTGFKPGLFSLTLNERFSVNGGYLGILEWILGKKDAMWIGFLTRTVLENSTSYEEAKNILTKTKILAPAYFILGGNQSGEGCVITRDRKESLDVYELDAKQGRWYVVQTNYDRWKNPFFLDDRRTPAKMCLNRTTQENISFENMYDVLSTKPVLNKLTVFTTLIDVTKDQFETYMRDCPDPCIGW |
Gene Information
Entrez Gene ID
Gene Name
N-acylsphingosine amidohydrolase (acid ceramidase) 1
Gene Symbol
Species
Macaca mulatta
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0005764 | IEA:InterPro | C | lysosome |
GO:0016811 | IEA:InterPro | F | hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in linear amides |
GO:0006629 | IEA:InterPro | P | lipid metabolic process |
KEGG Pathway Links
Domain Information
UniProt Annotations
Entry Information
Gene Name
N-acylsphingosine amidohydrolase (acid ceramidase) 1
UniProt ID
Species
Rhesus monkey
Identical and Related Proteins
Unique RefSeq proteins for LMP013833 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
109085735 | RefSeq | XP_001098236 | 411 | N-acylsphingosine amidohydrolase (acid ceramidase) 1 |
109085733 | RefSeq | XP_001098342 | 395 | N-acylsphingosine amidohydrolase (acid ceramidase) 1 |
Identical Sequences to LMP013833 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:109085735 | GenBank | EHH28310.1 | 411 | hypothetical protein EGK_18728 [Macaca mulatta] |
Related Sequences to LMP013833 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:109085735 | DBBJ | BAD51941.1 | 395 | N-acylsphingosine amidohydrolase 1 [Macaca fascicularis] |
GI:109085735 | GenBank | EHH64016.1 | 411 | hypothetical protein EGM_17119 [Macaca fascicularis] |
GI:109085735 | GenBank | AFE78316.1 | 395 | acid ceramidase isoform a preproprotein [Macaca mulatta] |
GI:109085735 | SwissProt | Q60HH4.1 | 395 | RecName: Full=Acid ceramidase; Short=AC; Short=ACDase; Short=Acid CDase; AltName: Full=Acylsphingosine deacylase; AltName: Full=N-acylsphingosine amidohydrolase; Contains: RecName: Full=Acid ceramidase subunit alpha; Contains: RecName: Full=Acid ceramidase subunit beta; Flags: Precursor [Macaca fascicularis] |