Gene/Proteome Database (LMPD)
Proteins
| Refseq ID | XP_001088617 |
| Protein GI | 109071169 |
| UniProt ID | F6U5K9 |
| mRNA ID | XM_001088617 |
| Length | 155 |
| MSESNNRPEYASFFAVMGASAAMVCSAPRAAYGTVKSRAGIAAMSVMRPELIMKSIVPVVMAGIIAIYGLVVAVLIASSLNDDISLYRSSLQLSAGLRVGPSGLAAGFAVGIVRNAGVRATAQQPRLFMGMILTLIFAEVLGLYGLIVALIHSTE | |
Gene Information
Entrez Gene ID
Gene Name
ATPase, H+ transporting, lysosomal 16kDa, V0 subunit c
Gene Symbol
Species
Macaca mulatta
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
| GO:0033179 | IEA:InterPro | C | proton-transporting V-type ATPase, V0 domain |
| GO:0015078 | IEA:InterPro | F | hydrogen ion transmembrane transporter activity |
| GO:0015991 | IEA:InterPro | P | ATP hydrolysis coupled proton transport |
KEGG Pathway Links
| KEGG Pathway ID | Description |
|---|---|
| ko04966 | Collecting duct acid secretion |
| mcc04966 | Collecting duct acid secretion |
| ko04142 | Lysosome |
| mcc04142 | Lysosome |
| mcc01100 | Metabolic pathways |
| ko00190 | Oxidative phosphorylation |
| mcc00190 | Oxidative phosphorylation |
| ko04145 | Phagosome |
| mcc04145 | Phagosome |
| ko05323 | Rheumatoid arthritis |
| mcc05323 | Rheumatoid arthritis |
| ko04721 | Synaptic vesicle cycle |
| mcc04721 | Synaptic vesicle cycle |
| ko05152 | Tuberculosis |
| mcc05152 | Tuberculosis |
Domain Information
UniProt Annotations
Entry Information
Gene Name
ATPase, H+ transporting, lysosomal 16kDa, V0 subunit c
Protein Entry
F6U5K9_MACMU
UniProt ID
Species
Rhesus monkey
Comments
| Comment Type | Description |
|---|---|
| Caution | The sequence shown here is derived from an Ensembl automatic analysis pipeline and should be considered as preliminary data. |
| Similarity | Belongs to the V-ATPase proteolipid subunit family. |
Identical and Related Proteins
Unique RefSeq proteins for LMP013848 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 109071169 | RefSeq | XP_001088617 | 155 | ATPase, H+ transporting, lysosomal 16kDa, V0 subunit c |
Identical Sequences to LMP013848 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:109071169 | RefSeq | XP_005553035.1 | 155 | PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit-like isoform X1 [Macaca fascicularis] |
| GI:109071169 | RefSeq | XP_005553036.1 | 155 | PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit-like isoform X2 [Macaca fascicularis] |
| GI:109071169 | RefSeq | XP_005553037.1 | 155 | PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit-like isoform X3 [Macaca fascicularis] |
| GI:109071169 | RefSeq | XP_005553038.1 | 155 | PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit-like isoform X4 [Macaca fascicularis] |
Related Sequences to LMP013848 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|