Gene/Proteome Database (LMPD)

LMPD ID
LMP013848
Gene ID
Species
Macaca mulatta (Rhesus monkey)
Gene Name
ATPase, H+ transporting, lysosomal 16kDa, V0 subunit c
Gene Symbol
Chromosome
4
Map Location
chromosome:4

Proteins

Refseq ID XP_001088617
Protein GI 109071169
UniProt ID F6U5K9
mRNA ID XM_001088617
Length 155
MSESNNRPEYASFFAVMGASAAMVCSAPRAAYGTVKSRAGIAAMSVMRPELIMKSIVPVVMAGIIAIYGLVVAVLIASSLNDDISLYRSSLQLSAGLRVGPSGLAAGFAVGIVRNAGVRATAQQPRLFMGMILTLIFAEVLGLYGLIVALIHSTE

Gene Information

Entrez Gene ID
Gene Name
ATPase, H+ transporting, lysosomal 16kDa, V0 subunit c
Gene Symbol
Species
Macaca mulatta

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0016021 IEA:UniProtKB-KW C integral component of membrane
GO:0033179 IEA:InterPro C proton-transporting V-type ATPase, V0 domain
GO:0015078 IEA:InterPro F hydrogen ion transmembrane transporter activity
GO:0015991 IEA:InterPro P ATP hydrolysis coupled proton transport

KEGG Pathway Links

KEGG Pathway ID Description
ko04966 Collecting duct acid secretion
mcc04966 Collecting duct acid secretion
ko04142 Lysosome
mcc04142 Lysosome
mcc01100 Metabolic pathways
ko00190 Oxidative phosphorylation
mcc00190 Oxidative phosphorylation
ko04145 Phagosome
mcc04145 Phagosome
ko05323 Rheumatoid arthritis
mcc05323 Rheumatoid arthritis
ko04721 Synaptic vesicle cycle
mcc04721 Synaptic vesicle cycle
ko05152 Tuberculosis
mcc05152 Tuberculosis

Domain Information

InterPro Annotations

Accession Description
IPR000245 V-ATPase proteolipid subunit
IPR011555 V-ATPase proteolipid subunit C, eukaryotic
IPR002379 V-ATPase proteolipid subunit C-like domain

UniProt Annotations

Entry Information

Gene Name
ATPase, H+ transporting, lysosomal 16kDa, V0 subunit c
Protein Entry
F6U5K9_MACMU
UniProt ID
Species
Rhesus monkey

Comments

Comment Type Description
Caution The sequence shown here is derived from an Ensembl automatic analysis pipeline and should be considered as preliminary data.
Similarity Belongs to the V-ATPase proteolipid subunit family.

Identical and Related Proteins

Unique RefSeq proteins for LMP013848 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
109071169 RefSeq XP_001088617 155 ATPase, H+ transporting, lysosomal 16kDa, V0 subunit c

Identical Sequences to LMP013848 proteins

Reference Database Accession Length Protein Name
GI:109071169 RefSeq XP_005553035.1 155 PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit-like isoform X1 [Macaca fascicularis]
GI:109071169 RefSeq XP_005553036.1 155 PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit-like isoform X2 [Macaca fascicularis]
GI:109071169 RefSeq XP_005553037.1 155 PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit-like isoform X3 [Macaca fascicularis]
GI:109071169 RefSeq XP_005553038.1 155 PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit-like isoform X4 [Macaca fascicularis]

Related Sequences to LMP013848 proteins

Reference Database Accession Length Protein Name