Gene/Proteome Database (LMPD)

LMPD ID
LMP013877
Gene ID
Species
Macaca mulatta (Rhesus monkey)
Gene Name
UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 4
Gene Symbol
Alternate Names
beta-1,4-galactosyltransferase 4;
Chromosome
2
Map Location
chromosome:2

Proteins

beta-1,4-galactosyltransferase 4
Refseq ID NP_001244761
Protein GI 383872254
UniProt ID F7HPG1
mRNA ID NM_001257832
Length 344
Protein sequence is identical to GI:109033183 (mRNA isoform)
Refseq ID XP_001108497
Protein GI 109033183
UniProt ID F7HPG1
mRNA ID XM_001108549
Length 344
MGFNLTFHLSYKLRLLLLLTLCLTVVGWATSNYFVGAIQEIPKAKELVANFHKALILGKGKTLTNEASTQKAELDNCPSVSPYLRGQSKLIFKPDLTLEEVQAENPKVSRGRYRPEECKALQRVAILIPHRNREKHLMYLLEHLHPFLQRQQLDYGIYVIHQAEGKKFNRAKLLNVGYLEALKEENWDCFIFHDVDLVPENDFNLYKCEEHPKHLVVGRNSTGYRLRYSGYFGGVTALSREQFFKVNGFSNNYWGWGGEDDDLRLRVELHRMKISRPLPEVGKYTMVFHTRDKGNEVNAERMKLLHQVSRVWRTDGLSSCSYKLVSVEHNPLYVNITVDFWSGA
Refseq ID XP_001108549
Protein GI 109033186
UniProt ID F7HPG1
mRNA ID XM_001108549
Length 344
Protein sequence is identical to GI:109033183 (mRNA isoform)

Gene Information

Entrez Gene ID
Gene Name
UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 4
Gene Symbol
Species
Macaca mulatta

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0016757 IEA:UniProtKB-KW F transferase activity, transferring glycosyl groups
GO:0005975 IEA:InterPro P carbohydrate metabolic process

KEGG Pathway Links

KEGG Pathway ID Description
ko00533 Glycosaminoglycan biosynthesis - keratan sulfate
mcc00533 Glycosaminoglycan biosynthesis - keratan sulfate
ko00601 Glycosphingolipid biosynthesis - lacto and neolacto series
mcc00601 Glycosphingolipid biosynthesis - lacto and neolacto series
M00071 Glycosphingolipid biosynthesis, neolacto-series, LacCer => nLc4Cer
mcc_M00071 Glycosphingolipid biosynthesis, neolacto-series, LacCer => nLc4Cer
mcc01100 Metabolic pathways

Domain Information

InterPro Annotations

Accession Description
IPR003859 Beta-1,4-galactosyltransferase
IPR027791 Galactosyltransferase, C-terminal
IPR027995 Galactosyltransferase, N-terminal
IPR029044 Nucleotide-diphospho-sugar transferases

UniProt Annotations

Entry Information

Gene Name
UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 4
Protein Entry
F7HPG1_MACMU
UniProt ID
Species
Rhesus monkey

Identical and Related Proteins

Unique RefSeq proteins for LMP013877 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
109033183 RefSeq XP_001108497 344 UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 4

Identical Sequences to LMP013877 proteins

Reference Database Accession Length Protein Name
GI:383872254 GenBank AFE80647.1 344 beta-1,4-galactosyltransferase 4 [Macaca mulatta]
GI:383872254 GenBank AFI34431.1 344 beta-1,4-galactosyltransferase 4 [Macaca mulatta]
GI:383872254 RefSeq XP_005548130.1 344 PREDICTED: beta-1,4-galactosyltransferase 4 isoform X1 [Macaca fascicularis]
GI:383872254 RefSeq XP_005548131.1 344 PREDICTED: beta-1,4-galactosyltransferase 4 isoform X2 [Macaca fascicularis]

Related Sequences to LMP013877 proteins

Reference Database Accession Length Protein Name
GI:383872254 GenBank EHH16082.1 344 hypothetical protein EGK_11319 [Macaca mulatta]
GI:383872254 GenBank EHH51046.1 344 hypothetical protein EGM_10369 [Macaca fascicularis]