Gene/Proteome Database (LMPD)
Proteins
beta-1,4-galactosyltransferase 4 | |
---|---|
Refseq ID | NP_001244761 |
Protein GI | 383872254 |
UniProt ID | F7HPG1 |
mRNA ID | NM_001257832 |
Length | 344 |
Protein sequence is identical to GI:109033183 (mRNA isoform) |
Refseq ID | XP_001108497 |
Protein GI | 109033183 |
UniProt ID | F7HPG1 |
mRNA ID | XM_001108549 |
Length | 344 |
MGFNLTFHLSYKLRLLLLLTLCLTVVGWATSNYFVGAIQEIPKAKELVANFHKALILGKGKTLTNEASTQKAELDNCPSVSPYLRGQSKLIFKPDLTLEEVQAENPKVSRGRYRPEECKALQRVAILIPHRNREKHLMYLLEHLHPFLQRQQLDYGIYVIHQAEGKKFNRAKLLNVGYLEALKEENWDCFIFHDVDLVPENDFNLYKCEEHPKHLVVGRNSTGYRLRYSGYFGGVTALSREQFFKVNGFSNNYWGWGGEDDDLRLRVELHRMKISRPLPEVGKYTMVFHTRDKGNEVNAERMKLLHQVSRVWRTDGLSSCSYKLVSVEHNPLYVNITVDFWSGA |
Refseq ID | XP_001108549 |
Protein GI | 109033186 |
UniProt ID | F7HPG1 |
mRNA ID | XM_001108549 |
Length | 344 |
Protein sequence is identical to GI:109033183 (mRNA isoform) |
Gene Information
Entrez Gene ID
Gene Name
UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 4
Gene Symbol
Species
Macaca mulatta
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0016757 | IEA:UniProtKB-KW | F | transferase activity, transferring glycosyl groups |
GO:0005975 | IEA:InterPro | P | carbohydrate metabolic process |
KEGG Pathway Links
KEGG Pathway ID | Description |
---|---|
ko00533 | Glycosaminoglycan biosynthesis - keratan sulfate |
mcc00533 | Glycosaminoglycan biosynthesis - keratan sulfate |
ko00601 | Glycosphingolipid biosynthesis - lacto and neolacto series |
mcc00601 | Glycosphingolipid biosynthesis - lacto and neolacto series |
M00071 | Glycosphingolipid biosynthesis, neolacto-series, LacCer => nLc4Cer |
mcc_M00071 | Glycosphingolipid biosynthesis, neolacto-series, LacCer => nLc4Cer |
mcc01100 | Metabolic pathways |
Domain Information
UniProt Annotations
Entry Information
Gene Name
UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 4
Protein Entry
F7HPG1_MACMU
UniProt ID
Species
Rhesus monkey
Identical and Related Proteins
Unique RefSeq proteins for LMP013877 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
109033183 | RefSeq | XP_001108497 | 344 | UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 4 |
Identical Sequences to LMP013877 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:383872254 | GenBank | AFE80647.1 | 344 | beta-1,4-galactosyltransferase 4 [Macaca mulatta] |
GI:383872254 | GenBank | AFI34431.1 | 344 | beta-1,4-galactosyltransferase 4 [Macaca mulatta] |
GI:383872254 | RefSeq | XP_005548130.1 | 344 | PREDICTED: beta-1,4-galactosyltransferase 4 isoform X1 [Macaca fascicularis] |
GI:383872254 | RefSeq | XP_005548131.1 | 344 | PREDICTED: beta-1,4-galactosyltransferase 4 isoform X2 [Macaca fascicularis] |
Related Sequences to LMP013877 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:383872254 | GenBank | EHH16082.1 | 344 | hypothetical protein EGK_11319 [Macaca mulatta] |
GI:383872254 | GenBank | EHH51046.1 | 344 | hypothetical protein EGM_10369 [Macaca fascicularis] |