Gene/Proteome Database (LMPD)

LMPD ID
LMP013881
Gene ID
100429419
Species
Macaca mulatta (Rhesus monkey)
Gene Name
bile acid CoA: amino acid N-acyltransferase (glycine N-choloyltransferase)
Gene Symbol
BAAT
Alternate Names
bile acid CoA: amino acid N-acyltransferase (glycine N-choloyltransferase); bile acid-CoA:amino acid N-acyltransferase; bile acid Coenzyme A: amino acid N-acyltransferase;
Chromosome
15
Map Location
chromosome:15

Proteins

Refseq ID XP_002800073
Protein GI 297270493
UniProt ID F7HT86
mRNA ID XM_002800027
Length 418
MIQLTATPVSALVDEPVHIQATGLTPFQMVSFQASLEDESGNMFYSQAHYRANEFGEVDLKHASSLGGDYMGVHPMGLFWSLKPEKLLTRLLKQDVMNKPFQVQLKLYDLELIVNNKAASAPKASLTLERWYVAPGVTRIQVREGRLRGALFLPPGEGRFPGVIDLFGGLGGLLEFRASLLASRGFASLALAYFNYEDLPAKPEVTDLEYFEEAANFLLRHPKVFGPGVGVVSVCQGVQIGLSMAVNLKQVTATVLINGTNFPFGIPQVYRGKIYQPFPYSAQLISTSALGLLELYRIYETTEVGASQYLFPVEEAQGHFLFIVGEGDKIINSKAHAEQAIAQLRRHGKNNWTLLSYPGAGHLIEPPYSPLCCASMTRDLKLHWGGEVIPHAAAQEHAWKEIQRFLRKHLIPDMTSPL

Gene Information

Entrez Gene ID
100429419
Gene Name
bile acid CoA: amino acid N-acyltransferase (glycine N-choloyltransferase)
Gene Symbol
BAAT
Species
Macaca mulatta

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005829 IEA:Ensembl C cytosol
GO:0005777 IEA:Ensembl C peroxisome
GO:0016410 IEA:Ensembl F N-acyltransferase activity
GO:0047963 IEA:Ensembl F glycine N-choloyltransferase activity
GO:0052815 IEA:Ensembl F medium-chain acyl-CoA hydrolase activity
GO:0052817 IEA:Ensembl F very long chain acyl-CoA hydrolase activity
GO:0006637 IEA:InterPro P acyl-CoA metabolic process
GO:0006699 IEA:Ensembl P bile acid biosynthetic process
GO:0002152 IEA:Ensembl P bile acid conjugation
GO:0006544 IEA:Ensembl P glycine metabolic process
GO:0019530 IEA:Ensembl P taurine metabolic process

KEGG Pathway Links

KEGG Pathway ID Description
ko04976 Bile secretion
mcc04976 Bile secretion
ko01040 Biosynthesis of unsaturated fatty acids
mcc01040 Biosynthesis of unsaturated fatty acids
M00106 Conjugated bile acid biosynthesis, cholate => taurocholate/glycocholate
mcc_M00106 Conjugated bile acid biosynthesis, cholate => taurocholate/glycocholate
mcc01100 Metabolic pathways
ko04146 Peroxisome
mcc04146 Peroxisome
ko00120 Primary bile acid biosynthesis
mcc00120 Primary bile acid biosynthesis
ko00430 Taurine and hypotaurine metabolism
mcc00430 Taurine and hypotaurine metabolism

Domain Information

InterPro Annotations

Accession Description
IPR006862 Acyl-CoA thioester hydrolase/bile acid-CoA amino acid N-acetyltransferase
IPR016662 Acyl-CoA thioesterase, long chain
IPR029058 Alpha/Beta hydrolase fold
IPR014940 BAAT/Acyl-CoA thioester hydrolase C-terminal

UniProt Annotations

Entry Information

Gene Name
bile acid CoA: amino acid N-acyltransferase (glycine N-choloyltransferase)
Protein Entry
F7HT86_MACMU
UniProt ID
F7HT86
Species
Rhesus monkey

Identical and Related Proteins

Unique RefSeq proteins for LMP013881 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
297270493 RefSeq XP_002800073 418 bile acid CoA: amino acid N-acyltransferase (glycine N-choloyltransferase)

Identical Sequences to LMP013881 proteins

Reference Database Accession Length Protein Name

Related Sequences to LMP013881 proteins

Reference Database Accession Length Protein Name
GI:297270493 RefSeq XP_003911485.1 418 PREDICTED: bile acid-CoA:amino acid N-acyltransferase isoform X1 [Papio anubis]
GI:297270493 RefSeq XP_005581230.1 418 PREDICTED: bile acid-CoA:amino acid N-acyltransferase isoform X1 [Macaca fascicularis]
GI:297270493 RefSeq XP_007966757.1 418 PREDICTED: bile acid-CoA:amino acid N-acyltransferase [Chlorocebus sabaeus]
GI:297270493 RefSeq XP_009186671.1 418 PREDICTED: bile acid-CoA:amino acid N-acyltransferase isoform X1 [Papio anubis]