Gene/Proteome Database (LMPD)
Proteins
cholesterol 25-hydroxylase | |
---|---|
Refseq ID | NP_001185628 |
Protein GI | 310923305 |
UniProt ID | F7EC50 |
mRNA ID | NM_001198699 |
Length | 272 |
Protein sequence is identical to GI:109089854 (mRNA isoform) |
Refseq ID | XP_001083208 |
Protein GI | 109089854 |
UniProt ID | F7EC50 |
mRNA ID | XM_001083208 |
Length | 272 |
MSYQNSSDPQVLCSSEQLFLQPLWDHLRSWEALIQSPFFPVIFSITTYVAFCLPFVVLDILCSWVPALRRYKIHPDFSPSARQLLPCLGQTLYQHVMFVFPVTLLHWASRPALLPHEAPELLLLLHHIVFCLLLFDTEFFVWHLLHHKVPWLYRTFHKVHHQNPSSFALATQYMSVWELFSLGFFDMMNVTLLGCHPLTSLTFHVVNIWLSVEDHSGYNFPWSTHRLVPFGWYGGVVHHDLHHSHFNCNFAPYFTHWDKILGTLRTASVTAR |
Gene Information
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
GO:0005506 | IEA:InterPro | F | iron ion binding |
GO:0008395 | IEA:Ensembl | F | steroid hydroxylase activity |
GO:0008203 | IEA:Ensembl | P | cholesterol metabolic process |
GO:0006633 | IEA:InterPro | P | fatty acid biosynthetic process |
KEGG Pathway Links
Domain Information
InterPro Annotations
Accession | Description |
---|---|
IPR006694 | Fatty_acid_hydroxylase |
UniProt Annotations
Entry Information
Gene Name
cholesterol 25-hydroxylase
Protein Entry
F7EC50_MACMU
UniProt ID
Species
Rhesus monkey
Identical and Related Proteins
Unique RefSeq proteins for LMP013914 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
109089854 | RefSeq | XP_001083208 | 272 | cholesterol 25-hydroxylase |
Identical Sequences to LMP013914 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:310923305 | GenBank | EHH19207.1 | 272 | hypothetical protein EGK_19877 [Macaca mulatta] |
GI:310923305 | GenBank | EHH64861.1 | 272 | hypothetical protein EGM_18188 [Macaca fascicularis] |
GI:310923305 | RefSeq | XP_005565960.1 | 272 | PREDICTED: cholesterol 25-hydroxylase [Macaca fascicularis] |
Related Sequences to LMP013914 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:310923305 | RefSeq | XP_003904026.1 | 272 | PREDICTED: cholesterol 25-hydroxylase [Papio anubis] |