Gene/Proteome Database (LMPD)

LMPD ID
LMP013914
Gene ID
Species
Macaca mulatta (Rhesus monkey)
Gene Name
cholesterol 25-hydroxylase
Gene Symbol
Alternate Names
cholesterol 25-hydroxylase;
Chromosome
9
Map Location
chromosome:9

Proteins

cholesterol 25-hydroxylase
Refseq ID NP_001185628
Protein GI 310923305
UniProt ID F7EC50
mRNA ID NM_001198699
Length 272
Protein sequence is identical to GI:109089854 (mRNA isoform)
Refseq ID XP_001083208
Protein GI 109089854
UniProt ID F7EC50
mRNA ID XM_001083208
Length 272
MSYQNSSDPQVLCSSEQLFLQPLWDHLRSWEALIQSPFFPVIFSITTYVAFCLPFVVLDILCSWVPALRRYKIHPDFSPSARQLLPCLGQTLYQHVMFVFPVTLLHWASRPALLPHEAPELLLLLHHIVFCLLLFDTEFFVWHLLHHKVPWLYRTFHKVHHQNPSSFALATQYMSVWELFSLGFFDMMNVTLLGCHPLTSLTFHVVNIWLSVEDHSGYNFPWSTHRLVPFGWYGGVVHHDLHHSHFNCNFAPYFTHWDKILGTLRTASVTAR

Gene Information

Entrez Gene ID
Gene Name
cholesterol 25-hydroxylase
Gene Symbol
Species
Macaca mulatta

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0016021 IEA:UniProtKB-KW C integral component of membrane
GO:0005506 IEA:InterPro F iron ion binding
GO:0008395 IEA:Ensembl F steroid hydroxylase activity
GO:0008203 IEA:Ensembl P cholesterol metabolic process
GO:0006633 IEA:InterPro P fatty acid biosynthetic process

KEGG Pathway Links

KEGG Pathway ID Description
ko00120 Primary bile acid biosynthesis
mcc00120 Primary bile acid biosynthesis

Domain Information

InterPro Annotations

Accession Description
IPR006694 Fatty_acid_hydroxylase

UniProt Annotations

Entry Information

Gene Name
cholesterol 25-hydroxylase
Protein Entry
F7EC50_MACMU
UniProt ID
Species
Rhesus monkey

Identical and Related Proteins

Unique RefSeq proteins for LMP013914 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
109089854 RefSeq XP_001083208 272 cholesterol 25-hydroxylase

Identical Sequences to LMP013914 proteins

Reference Database Accession Length Protein Name
GI:310923305 GenBank EHH19207.1 272 hypothetical protein EGK_19877 [Macaca mulatta]
GI:310923305 GenBank EHH64861.1 272 hypothetical protein EGM_18188 [Macaca fascicularis]
GI:310923305 RefSeq XP_005565960.1 272 PREDICTED: cholesterol 25-hydroxylase [Macaca fascicularis]

Related Sequences to LMP013914 proteins

Reference Database Accession Length Protein Name
GI:310923305 RefSeq XP_003904026.1 272 PREDICTED: cholesterol 25-hydroxylase [Papio anubis]