Gene/Proteome Database (LMPD)
Proteins
| Refseq ID | XP_001105018 |
| Protein GI | 108999236 |
| UniProt ID | F6Z3G5 |
| mRNA ID | XM_001105018 |
| Length | 360 |
| MEECWVTEIANGSKNGLDFNPMKDYMILSGPQKIAIAVLCTLLGLLSALENVAVLYLILSSHRLRQKPSYLFIGSLAGADFLASVVFACSFVNFHVFHGMDSKAVFLLKIGSVTMTFTASVGSLLLTAIDRYLCLRYPPSYKALLTRGRALVTLGIMWVLSALVSYLPLMGWTCCPRPCSELFPLIPNDYLLGWLLFIAFLFSGIIYTYGHVLWKAHQHVASLSGHQDRQVPGMARMRLDVRLAKTLGLVLAVLLICWFPVLALMVHSLATTLSDQVKKAFAFCSMLCLVNSMVNPVIYALRSGEIRSSAHHCLAHWRKCVRGLGSEAKEEAPRSSVTETEADGKITPWPDSRDLDHSSC | |
Gene Information
Entrez Gene ID
Gene Name
cannabinoid receptor 2 (macrophage)
Gene Symbol
Species
Macaca mulatta
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
| GO:0004949 | IEA:InterPro | F | cannabinoid receptor activity |
KEGG Pathway Links
Domain Information
UniProt Annotations
Entry Information
Gene Name
cannabinoid receptor 2 (macrophage)
Protein Entry
F6Z3G5_MACMU
UniProt ID
Species
Rhesus monkey
Comments
| Comment Type | Description |
|---|---|
| Caution | The sequence shown here is derived from an Ensembl automatic analysis pipeline and should be considered as preliminary data. |
| Similarity | Belongs to the G-protein coupled receptor 1 family. |
Identical and Related Proteins
Unique RefSeq proteins for LMP013930 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 108999236 | RefSeq | XP_001105018 | 360 | cannabinoid receptor 2 (macrophage) |
Identical Sequences to LMP013930 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:108999236 | GenBank | EHH49649.1 | 360 | hypothetical protein EGM_00347 [Macaca fascicularis] |
| GI:108999236 | RefSeq | XP_005544509.1 | 360 | PREDICTED: cannabinoid receptor 2 isoform X1 [Macaca fascicularis] |
| GI:108999236 | RefSeq | XP_005544510.1 | 360 | PREDICTED: cannabinoid receptor 2 isoform X2 [Macaca fascicularis] |
Related Sequences to LMP013930 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:108999236 | GenBank | EHH14449.1 | 360 | hypothetical protein EGK_00376 [Macaca mulatta] |