Gene/Proteome Database (LMPD)
Proteins
Refseq ID | XP_001107715 |
Protein GI | 109082058 |
UniProt ID | F7HEV1 |
mRNA ID | XM_001107715 |
Length | 137 |
MPNFAGTWKMRSSENFDELLKALGVNAMLRKVAVAAASKPHVEIRQDGDQFYIKTSTTVRTTEINFKVGEGFEEETVDGRKCRSLATWENENKIHCTQTLLEGDGPKTYWTRELANDELILTFGADDVVCTRIYVRE |
Gene Information
Entrez Gene ID
Gene Name
cellular retinoic acid binding protein 1
Gene Symbol
Species
Macaca mulatta
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0005737 | IEA:Ensembl | C | cytoplasm |
GO:0008289 | IEA:InterPro | F | lipid binding |
GO:0005215 | IEA:InterPro | F | transporter activity |
Domain Information
UniProt Annotations
Entry Information
Gene Name
cellular retinoic acid binding protein 1
Protein Entry
F7HEV1_MACMU
UniProt ID
Species
Rhesus monkey
Identical and Related Proteins
Unique RefSeq proteins for LMP013944 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
109082058 | RefSeq | XP_001107715 | 137 | cellular retinoic acid binding protein 1 |
Identical Sequences to LMP013944 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:109082058 | RefSeq | XP_008013910.1 | 137 | PREDICTED: cellular retinoic acid-binding protein 1 [Chlorocebus sabaeus] |
GI:109082058 | RefSeq | XP_008052508.1 | 137 | PREDICTED: cellular retinoic acid-binding protein 1 [Tarsius syrichta] |
GI:109082058 | RefSeq | XP_008531041.1 | 137 | PREDICTED: cellular retinoic acid-binding protein 1 [Equus przewalskii] |
GI:109082058 | RefSeq | XP_010381454.1 | 137 | PREDICTED: cellular retinoic acid-binding protein 1 [Rhinopithecus roxellana] |
Related Sequences to LMP013944 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:109082058 | DBBJ | BAJ84031.1 | 137 | cellular retinoic acid-binding protein 1 [Homo sapiens] |
GI:109082058 | GenBank | AAE06122.1 | 137 | Sequence 4 from patent US 5871909 |
GI:109082058 | RefSeq | NP_004369.1 | 137 | cellular retinoic acid-binding protein 1 [Homo sapiens] |
GI:109082058 | RefSeq | XP_001142851.2 | 137 | PREDICTED: cellular retinoic acid-binding protein 1 [Pan troglodytes] |