Gene/Proteome Database (LMPD)
Proteins
| NADH-cytochrome b5 reductase 3 | |
|---|---|
| Refseq ID | NP_001165640 |
| Protein GI | 288541407 |
| UniProt ID | F6SJ84 |
| mRNA ID | NM_001172169 |
| Length | 301 |
| MGAQLSTLGHVVLSPVWFLYSLLMKLFRRSTPAITLESPDIKYSLRLIDREIISHDTRRFRFALPSPEHILGLPVGQHIYLSAQIDGNLVIRPYTPVSSDDDKGFVDLVIKVYFKDTHPKFPAGGKMSQYLESMQIGDTIEFRGPNGLLVYQGKGKFAIRPDKKSNPVIKTVKSVGMIAGGTGITPMLQVIRAIMKDPDDHTVCHLLFANQTEKDILLRPELEELRNEHSARFKLWYTLDRAPEAWDYSQGFVNEEMIRDHLPPPEEEPLVLMCGPPPMIQYACLPNLDRVGHPKERCFAF | |
Gene Information
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005783 | IEA:Ensembl | C | endoplasmic reticulum |
| GO:0070062 | IEA:Ensembl | C | extracellular vesicular exosome |
| GO:0005811 | IEA:Ensembl | C | lipid particle |
| GO:0005743 | IEA:Ensembl | C | mitochondrial inner membrane |
| GO:0071949 | IEA:Ensembl | F | FAD binding |
| GO:0016491 | IEA:UniProtKB-KW | F | oxidoreductase activity |
KEGG Pathway Links
Domain Information
InterPro Annotations
| Accession | Description |
|---|---|
| IPR017927 | Ferredoxin reductase-type FAD-binding domain |
| IPR001709 | Flavoprotein pyridine nucleotide cytochrome reductase |
| IPR001834 | NADH:cytochrome b5 reductase (CBR) |
| IPR001433 | Oxidoreductase FAD/NAD(P)-binding |
| IPR008333 | Oxidoreductase, FAD-binding domain |
| IPR017938 | Riboflavin synthase-like beta-barrel |
UniProt Annotations
Entry Information
Gene Name
cytochrome b5 reductase 3
Protein Entry
F6SJ84_MACMU
UniProt ID
Species
Rhesus monkey
Comments
| Comment Type | Description |
|---|---|
| Catalytic Activity | NADH + 2 ferricytochrome b5 = NAD(+) + H(+) + 2 ferrocytochrome b5. |
| Caution | The sequence shown here is derived from an Ensembl automatic analysis pipeline and should be considered as preliminary data. |
| Cofactor | Note=FAD. {ECO:0000256|RuleBase:RU361226, ECO:0000256|SAAS:SAAS00116536}; |
| Similarity | Belongs to the flavoprotein pyridine nucleotide cytochrome reductase family. |
| Similarity | Contains 1 FAD-binding FR-type domain. |
| Similarity | Contains FAD-binding FR-type domain. |
Identical and Related Proteins
Unique RefSeq proteins for LMP013965 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 288541407 | RefSeq | NP_001165640 | 301 | NADH-cytochrome b5 reductase 3 |
Identical Sequences to LMP013965 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|
Related Sequences to LMP013965 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:288541407 | GenBank | AFE76978.1 | 301 | NADH-cytochrome b5 reductase 3 isoform 1 [Macaca mulatta] |
| GI:288541407 | GenBank | AFH31345.1 | 301 | NADH-cytochrome b5 reductase 3 isoform 1 [Macaca mulatta] |
| GI:288541407 | RefSeq | XP_003905691.1 | 301 | PREDICTED: NADH-cytochrome b5 reductase 3 isoform X1 [Papio anubis] |
| GI:288541407 | RefSeq | XP_005567155.1 | 301 | PREDICTED: NADH-cytochrome b5 reductase 3-like isoform X1 [Macaca fascicularis] |