Gene/Proteome Database (LMPD)
LMPD ID
LMP013981
Gene ID
Species
Macaca mulatta (Rhesus monkey)
Gene Name
cytochrome P450, family 2, subfamily E, polypeptide 1
Gene Symbol
Alternate Names
cytochrome P450 2E1; CYPIIE1; cytochrome P450 CYP2E1; 4-nitrophenol 2-hydroxylase;
Chromosome
9
Map Location
chromosome:9
EC Number
1.14.13.-
Proteins
cytochrome P450 2E1 precursor | |
---|---|
Refseq ID | NP_001035303 |
Protein GI | 94158996 |
UniProt ID | Q6GUQ4 |
mRNA ID | NM_001040213 |
Length | 493 |
MSALGVSVALLVWVAVLLLVSIWRQVHSSWNLPPGPFPLPIIGNLFQLELKNIPKSFTRLAQRFGPVFTLYVGSRRVVVVHGYKAVREVLLDHKDEFSGRGDIPAFHAHRDRGIIFNNGPTWKDIRRFSLTTLRNYGMGKQGNESRIQREAHFLLEALRKTQGQPFDPTFLIGCAPCNVIADILFRKHFDYNDEKFLRLMYLFNENFQLLSTPWLQLYNNFPSLLHYLPGSHRKVMKNVAEIKEYVSERVKEHLQSLDPNCPRDLTDCLLVEMEKEKHSAERLYTMDGITVTVADLFFAGTETTSTTLRYGLLILMKYPEIEEKLHEEIDRVIGPSRIPAIKDRQEMPYMDAVVHEIQRFITLVPSNLPHEATRDTIFRGYIIPKGTVIVPTLDSVLYDNQEFPDPEKFKPEHFLDESGKFKYSDYFKPFSAGKRVCAGEGLARMELFLLLSAILQHFNLKPLVDPKDIDISPVNIGFGCIPPRFKLCVIPRS | |
sig_peptide: 1..28 inference: COORDINATES: ab initio prediction:SignalP:4.0 calculated_mol_wt: 3048 peptide sequence: MSALGVSVALLVWVAVLLLVSIWRQVHS |
Gene Information
Entrez Gene ID
Gene Name
cytochrome P450, family 2, subfamily E, polypeptide 1
Gene Symbol
Species
Macaca mulatta
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0005783 | IEA:UniProtKB-KW | C | endoplasmic reticulum |
GO:0016020 | IEA:UniProtKB-KW | C | membrane |
GO:0020037 | ISS:UniProtKB | F | heme binding |
GO:0005506 | IEA:InterPro | F | iron ion binding |
GO:0016709 | IEA:UniProtKB-EC | F | oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, NAD(P)H as one donor, and incorporation of one atom of oxygen |
GO:0016712 | IEA:InterPro | F | oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen |
KEGG Pathway Links
KEGG Pathway ID | Description |
---|---|
ko00590 | Arachidonic acid metabolism |
mcc00590 | Arachidonic acid metabolism |
ko05204 | Chemical carcinogenesis |
mcc05204 | Chemical carcinogenesis |
ko00982 | Drug metabolism - cytochrome P450 |
mcc00982 | Drug metabolism - cytochrome P450 |
ko00591 | Linoleic acid metabolism |
mcc00591 | Linoleic acid metabolism |
mcc01100 | Metabolic pathways |
ko00980 | Metabolism of xenobiotics by cytochrome P450 |
mcc00980 | Metabolism of xenobiotics by cytochrome P450 |
ko04932 | Non-alcoholic fatty liver disease (NAFLD) |
mcc04932 | Non-alcoholic fatty liver disease (NAFLD) |
ko00140 | Steroid hormone biosynthesis |
mcc00140 | Steroid hormone biosynthesis |
Domain Information
UniProt Annotations
Entry Information
Gene Name
cytochrome P450, family 2, subfamily E, polypeptide 1
Protein Entry
CP2E1_MACMU
UniProt ID
Species
Rhesus monkey
Comments
Comment Type | Description |
---|---|
Catalytic Activity | 4-nitrophenol + NADPH + O(2) = 4-nitrocatechol + NADP(+) + H(2)O. |
Cofactor | Name=heme; Xref=ChEBI:CHEBI:30413; Evidence= ; |
Function | Metabolizes several precarcinogens, drugs, and solvents to reactive metabolites. |
Induction | By ethanol. |
Similarity | Belongs to the cytochrome P450 family. |
Subcellular Location | Endoplasmic reticulum membrane; Peripheral membrane protein. Microsome membrane; Peripheral membrane protein. |
Identical and Related Proteins
Unique RefSeq proteins for LMP013981 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
94158996 | RefSeq | NP_001035303 | 493 | cytochrome P450 2E1 precursor |
Identical Sequences to LMP013981 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:94158996 | GenBank | AAT49269.1 | 493 | cytochrome P450 CYP2E1 [Macaca mulatta] |
GI:94158996 | SwissProt | Q6GUQ4.1 | 493 | RecName: Full=Cytochrome P450 2E1; AltName: Full=4-nitrophenol 2-hydroxylase; AltName: Full=CYPIIE1 [Macaca mulatta] |
Related Sequences to LMP013981 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:94158996 | RefSeq | XP_008015474.1 | 559 | PREDICTED: cytochrome P450 2E1 [Chlorocebus sabaeus] |
GI:94158996 | RefSeq | XP_010385239.1 | 493 | PREDICTED: cytochrome P450 2E1 [Rhinopithecus roxellana] |