Gene/Proteome Database (LMPD)

LMPD ID
LMP013992
Gene ID
711840
Species
Macaca mulatta (Rhesus monkey)
Gene Name
defender against cell death 1
Gene Symbol
DAD1
Alternate Names
dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1;
Chromosome
7
Map Location
chromosome:7
EC Number
2.4.99.18

Proteins

dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1
Refseq ID NP_001181060
Protein GI 302564564
UniProt ID F6Q1Z9
mRNA ID NM_001194131
Length 113
Protein sequence is identical to GI:109082853 (mRNA isoform)
Refseq ID XP_001099561
Protein GI 109082853
UniProt ID F6Q1Z9
mRNA ID XM_001099561
Length 113
MSASVVSVISRFLEEYLSSTPQRLKLLDAYLLYILLTGALQFGYCLLVGTFPFNSFLSGFISCVGSFILAVCLRIQINPQNKADFQGISPERAFADFLFASTILHLVVMNFVG

Gene Information

Entrez Gene ID
711840
Gene Name
defender against cell death 1
Gene Symbol
DAD1
Species
Macaca mulatta

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0070062 IEA:Ensembl C extracellular vesicular exosome
GO:0016021 IEA:UniProtKB-KW C integral component of membrane
GO:0008250 ISS:UniProtKB C oligosaccharyltransferase complex
GO:0004579 IEA:InterPro F dolichyl-diphosphooligosaccharide-protein glycotransferase activity
GO:0001824 IEA:Ensembl P blastocyst development
GO:0043066 IEA:Ensembl P negative regulation of apoptotic process
GO:0006486 ISS:UniProtKB P protein glycosylation

KEGG Pathway Links

KEGG Pathway ID Description
mcc01100 Metabolic pathways
ko00510 N-Glycan biosynthesis
mcc00510 N-Glycan biosynthesis
M00072 N-glycosylation by oligosaccharyltransferase
mcc_M00072 N-glycosylation by oligosaccharyltransferase
ko04141 Protein processing in endoplasmic reticulum
mcc04141 Protein processing in endoplasmic reticulum

Domain Information

InterPro Annotations

Accession Description
IPR003038 DAD/Ost2

UniProt Annotations

Entry Information

Gene Name
defender against cell death 1
Protein Entry
F6Q1Z9_MACMU
UniProt ID
F6Q1Z9
Species
Rhesus monkey

Comments

Comment Type Description
Catalytic Activity Dolichyl diphosphooligosaccharide + [protein]- L-asparagine = dolichyl diphosphate + a glycoprotein with the oligosaccharide chain attached by N-beta-D-glycosyl linkage to a protein L-asparagine.
Function Essential subunit of the N-oligosaccharyl transferase (OST) complex which catalyzes the transfer of a high mannose oligosaccharide from a lipid-linked oligosaccharide donor to an asparagine residue within an Asn-X-Ser/Thr consensus motif in nascent polypeptide chains.
Pathway Protein modification; protein glycosylation.
Similarity Belongs to the DAD/OST2 family.
Subcellular Location Endoplasmic reticulum membrane ; Multi-pass membrane protein
Subunit Component of the oligosaccharyltransferase (OST) complex.

Identical and Related Proteins

Unique RefSeq proteins for LMP013992 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
109082853 RefSeq XP_001099561 113 defender against cell death 1

Identical Sequences to LMP013992 proteins

Reference Database Accession Length Protein Name
GI:302564564 RefSeq XP_008588297.1 113 PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1 isoform X2 [Galeopterus variegatus]
GI:302564564 RefSeq XP_008708740.1 113 PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1 [Ursus maritimus]
GI:302564564 RefSeq XP_008838140.1 113 PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1 [Nannospalax galili]
GI:302564564 RefSeq XP_010376647.1 113 PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1 [Rhinopithecus roxellana]

Related Sequences to LMP013992 proteins

Reference Database Accession Length Protein Name
GI:302564564 DBBJ BAA03651.1 113 DAD-1 [Mesocricetus auratus]
GI:302564564 DBBJ BAA03650.1 113 DAD-1 [Homo sapiens]
GI:302564564 GenBank AAC53359.1 113 defender against cell death 1 protein [Mus musculus]
GI:302564564 GenBank AAB58539.1 113 defender against death 1 protein [Mus musculus]