Gene/Proteome Database (LMPD)
Proteins
| Refseq ID | XP_001103096 |
| Protein GI | 109094318 |
| mRNA ID | XM_001103096 |
| Length | 102 |
| MSQAEFEKAAEEVKHLKTKPADDEMLFIYGRYKQATVGDVNTERPRMLDFTGKAKWDAWNELKGTTKEDAMKAYINKVEELKKKIRDMSDWIWLLGHVFLLN | |
Gene Information
Domain Information
InterPro Annotations
| Accession | Description |
|---|
UniProt Annotations
Entry Information
Gene Name
diazepam binding inhibitor (GABA receptor modulator, acyl-CoA binding protein)
Species
Rhesus monkey
Identical and Related Proteins
Unique RefSeq proteins for LMP013995 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 109094318 | RefSeq | XP_001103096 | 102 |
Identical Sequences to LMP013995 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:109094318 | RefSeq | XP_005567222.1 | 102 | PREDICTED: acyl-CoA-binding protein-like [Macaca fascicularis] |
Related Sequences to LMP013995 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:109094318 | RefSeq | XP_003281764.1 | 87 | PREDICTED: acyl-CoA-binding protein isoform 1 [Nomascus leucogenys] |
| GI:109094318 | RefSeq | XP_004091657.1 | 87 | PREDICTED: acyl-CoA-binding protein isoform 2 [Nomascus leucogenys] |
| GI:109094318 | RefSeq | XP_004091658.1 | 87 | PREDICTED: acyl-CoA-binding protein isoform 3 [Nomascus leucogenys] |