Gene/Proteome Database (LMPD)
Proteins
| Refseq ID | XP_001112326 |
| Protein GI | 109097153 |
| UniProt ID | F6ZHF9 |
| mRNA ID | XM_001112709 |
| Length | 735 |
| MAKERGLISPSDFAQLQKYMEYSTKKVSDVLKLFEDGEMAKYVQGDAIGYEGFQQFLKIYLEVDNVPRHLSLALFQSFKTDHCLNEANVTKDVGCLNDVSCYFSLLEGGRPENKLEFTFKLYDTDRNGILDSSEVDKIILQMMRVAEYLDWDVSELRPILQEMMKEIDYDGSGSVSQAEWVRAGATTVPLLVLLGLEMTLKDDGQHMWRPKRFPRPVYCNLCESSIGLGKQGLSCNLCKYTVHDQCAMKALPCEVSTYAKSRKDIGVQSHVWVRGGCESGRCDRCQKKIRIYHSLTGLHCVWCHLEIHDDCLQAVGHECDCGLLRDHILPPSSIYPSVLASGPDRKNSKTSQKTMDDLNLSTSEALRIDPVPNTHPLLVFVNPKSGGKQGQRVLWKFQYILNPRQVFNLLKDGPEIGLRLFKDVPDGRILVCGGDGTVGWILETIDKANLPVLPPVAVLPLGTGNDLARCLRWGGGYEGQNLAKILKDLETSKVVHMDRWSVEVIPQQTEEKSDPVPFQIINNYFSIGVDASIAHRFHIMREKYPEKFNSRMKNKLWYFEFATSESIFSTCKKLEESLTVEICGKPLDLSNLSLEGIAVLNIPSMHGGSNLWGDTRKPHGDIYGINQALGATAKVITDPDILKTCVPDLSDKRLEVVGLEGAIEMGQIYTKLKNAGRRLAKCSEITFHTTKTLPMQIDGEPWMQTPCTIKITHKNQMPMLMGPPPRSTNFFGFLS | |
| Refseq ID | XP_001112709 |
| Protein GI | 109097165 |
| UniProt ID | F6ZHF9 |
| mRNA ID | XM_001112709 |
| Length | 735 |
| Protein sequence is identical to GI:109097153 (mRNA isoform) | |
| Refseq ID | XP_001112464 |
| Protein GI | 109097157 |
| UniProt ID | F6ZHF9 |
| mRNA ID | XM_001112709 |
| Length | 735 |
| Protein sequence is identical to GI:109097153 (mRNA isoform) | |
| Refseq ID | XP_001112558 |
| Protein GI | 109097163 |
| UniProt ID | F6ZHF9 |
| mRNA ID | XM_001112709 |
| Length | 735 |
| Protein sequence is identical to GI:109097153 (mRNA isoform) | |
| Refseq ID | XP_001112430 |
| Protein GI | 109097155 |
| UniProt ID | F6ZHF9 |
| mRNA ID | XM_001112709 |
| Length | 735 |
| Protein sequence is identical to GI:109097153 (mRNA isoform) | |
Gene Information
Entrez Gene ID
Gene Name
diacylglycerol kinase, alpha 80kDa
Gene Symbol
Species
Macaca mulatta
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005829 | IEA:Ensembl | C | cytosol |
| GO:0005886 | IEA:Ensembl | C | plasma membrane |
| GO:0005524 | IEA:UniProtKB-KW | F | ATP binding |
| GO:0003951 | IEA:InterPro | F | NAD+ kinase activity |
| GO:0005509 | IEA:InterPro | F | calcium ion binding |
| GO:0004143 | IEA:UniProtKB-EC | F | diacylglycerol kinase activity |
| GO:0005543 | IEA:Ensembl | F | phospholipid binding |
| GO:0035556 | IEA:InterPro | P | intracellular signal transduction |
| GO:0007205 | IEA:InterPro | P | protein kinase C-activating G-protein coupled receptor signaling pathway |
KEGG Pathway Links
Domain Information
InterPro Annotations
| Accession | Description |
|---|---|
| IPR016064 | ATP-NAD kinase-like domain |
| IPR029477 | Diacylglycerol kinase type I, N-terminal |
| IPR000756 | Diacylglycerol kinase, accessory domain |
| IPR001206 | Diacylglycerol kinase, catalytic domain |
| IPR018247 | EF-Hand 1, calcium-binding site |
| IPR002048 | EF-hand domain |
| IPR011992 | EF-hand domain pair |
| IPR002219 | Protein kinase C-like, phorbol ester/diacylglycerol-binding domain |
UniProt Annotations
Entry Information
Gene Name
diacylglycerol kinase, alpha 80kDa
Protein Entry
F6ZHF9_MACMU
UniProt ID
Species
Rhesus monkey
Comments
| Comment Type | Description |
|---|---|
| Catalytic Activity | ATP + 1,2-diacyl-sn-glycerol = ADP + 1,2- diacyl-sn-glycerol 3-phosphate. |
| Caution | The sequence shown here is derived from an Ensembl automatic analysis pipeline and should be considered as preliminary data. |
| Similarity | Belongs to the eukaryotic diacylglycerol kinase family. |
| Similarity | Contains 1 DAGKc domain. |
| Similarity | Contains 2 EF-hand domains. |
| Similarity | Contains 2 phorbol-ester/DAG-type zinc fingers. |
Identical and Related Proteins
Unique RefSeq proteins for LMP014004 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 109097153 | RefSeq | XP_001112326 | 735 | diacylglycerol kinase, alpha 80kDa |
Identical Sequences to LMP014004 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:109097153 | RefSeq | XP_001112430.1 | 735 | PREDICTED: diacylglycerol kinase alpha-like isoform 6 [Macaca mulatta] |
| GI:109097153 | RefSeq | XP_001112464.1 | 735 | PREDICTED: diacylglycerol kinase alpha-like isoform 7 [Macaca mulatta] |
| GI:109097153 | RefSeq | XP_001112558.1 | 735 | PREDICTED: diacylglycerol kinase alpha-like isoform 10 [Macaca mulatta] |
| GI:109097153 | RefSeq | XP_001112709.1 | 735 | PREDICTED: diacylglycerol kinase alpha-like isoform 13 [Macaca mulatta] |
Related Sequences to LMP014004 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|