Gene/Proteome Database (LMPD)

LMPD ID
LMP014032
Gene ID
Species
Macaca mulatta (Rhesus monkey)
Gene Name
dolichyl-phosphate mannosyltransferase polypeptide 2, regulatory subunit
Gene Symbol
Alternate Names
dolichol phosphate-mannose biosynthesis regulatory protein;
Chromosome
15
Map Location
chromosome:15

Proteins

dolichol phosphate-mannose biosynthesis regulatory protein
Refseq ID NP_001247757
Protein GI 386780604
UniProt ID H9EXG6
mRNA ID NM_001260828
Length 84
Protein sequence is identical to GI:109112147 (mRNA isoform)
Refseq ID XP_001093450
Protein GI 109112147
UniProt ID H9EXG6
mRNA ID XM_001093450
Length 84
MATGTDQVVGLGLVAVSLIIFTYYTAWVILLPFIDSEHVIHKYFLPRAYAVAIPLAAGLLLLLFVGLFITYVMLKSERVTKKAQ

Gene Information

Entrez Gene ID
Gene Name
dolichyl-phosphate mannosyltransferase polypeptide 2, regulatory subunit
Gene Symbol
Species
Macaca mulatta

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0030176 IEA:InterPro C integral component of endoplasmic reticulum membrane
GO:0009059 IEA:InterPro P macromolecule biosynthetic process

KEGG Pathway Links

KEGG Pathway ID Description
ko00563 Glycosylphosphatidylinositol(GPI)-anchor biosynthesis
mcc00563 Glycosylphosphatidylinositol(GPI)-anchor biosynthesis
mcc01100 Metabolic pathways
ko00510 N-Glycan biosynthesis
mcc00510 N-Glycan biosynthesis

Domain Information

InterPro Annotations

Accession Description
IPR009914 Dolichol phosphate-mannose biosynthesis regulatory

UniProt Annotations

Entry Information

Gene Name
dolichyl-phosphate mannosyltransferase polypeptide 2, regulatory subunit
Protein Entry
H9EXG6_MACMU
UniProt ID
Species
Rhesus monkey

Identical and Related Proteins

Unique RefSeq proteins for LMP014032 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
109112147 RefSeq XP_001093450 84 dolichyl-phosphate mannosyltransferase polypeptide 2, regulatory subunit

Identical Sequences to LMP014032 proteins

Reference Database Accession Length Protein Name
GI:386780604 GenBank AFE67075.1 84 dolichol phosphate-mannose biosynthesis regulatory protein [Macaca mulatta]
GI:386780604 GenBank AFH34464.1 84 dolichol phosphate-mannose biosynthesis regulatory protein [Macaca mulatta]
GI:386780604 RefSeq XP_003911957.1 84 PREDICTED: dolichol phosphate-mannose biosynthesis regulatory protein [Papio anubis]
GI:386780604 RefSeq XP_005582197.1 84 PREDICTED: dolichol phosphate-mannose biosynthesis regulatory protein [Macaca fascicularis]

Related Sequences to LMP014032 proteins

Reference Database Accession Length Protein Name