Gene/Proteome Database (LMPD)
Proteins
| dolichol phosphate-mannose biosynthesis regulatory protein | |
|---|---|
| Refseq ID | NP_001247757 |
| Protein GI | 386780604 |
| UniProt ID | H9EXG6 |
| mRNA ID | NM_001260828 |
| Length | 84 |
| Protein sequence is identical to GI:109112147 (mRNA isoform) | |
| Refseq ID | XP_001093450 |
| Protein GI | 109112147 |
| UniProt ID | H9EXG6 |
| mRNA ID | XM_001093450 |
| Length | 84 |
| MATGTDQVVGLGLVAVSLIIFTYYTAWVILLPFIDSEHVIHKYFLPRAYAVAIPLAAGLLLLLFVGLFITYVMLKSERVTKKAQ | |
Gene Information
Entrez Gene ID
Gene Name
dolichyl-phosphate mannosyltransferase polypeptide 2, regulatory subunit
Gene Symbol
Species
Macaca mulatta
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0030176 | IEA:InterPro | C | integral component of endoplasmic reticulum membrane |
| GO:0009059 | IEA:InterPro | P | macromolecule biosynthetic process |
KEGG Pathway Links
Domain Information
InterPro Annotations
| Accession | Description |
|---|---|
| IPR009914 | Dolichol phosphate-mannose biosynthesis regulatory |
UniProt Annotations
Entry Information
Gene Name
dolichyl-phosphate mannosyltransferase polypeptide 2, regulatory subunit
Protein Entry
H9EXG6_MACMU
UniProt ID
Species
Rhesus monkey
Identical and Related Proteins
Unique RefSeq proteins for LMP014032 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 109112147 | RefSeq | XP_001093450 | 84 | dolichyl-phosphate mannosyltransferase polypeptide 2, regulatory subunit |
Identical Sequences to LMP014032 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:386780604 | GenBank | AFE67075.1 | 84 | dolichol phosphate-mannose biosynthesis regulatory protein [Macaca mulatta] |
| GI:386780604 | GenBank | AFH34464.1 | 84 | dolichol phosphate-mannose biosynthesis regulatory protein [Macaca mulatta] |
| GI:386780604 | RefSeq | XP_003911957.1 | 84 | PREDICTED: dolichol phosphate-mannose biosynthesis regulatory protein [Papio anubis] |
| GI:386780604 | RefSeq | XP_005582197.1 | 84 | PREDICTED: dolichol phosphate-mannose biosynthesis regulatory protein [Macaca fascicularis] |
Related Sequences to LMP014032 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|