Gene/Proteome Database (LMPD)
Proteins
dolichol phosphate-mannose biosynthesis regulatory protein | |
---|---|
Refseq ID | NP_001247757 |
Protein GI | 386780604 |
UniProt ID | H9EXG6 |
mRNA ID | NM_001260828 |
Length | 84 |
Protein sequence is identical to GI:109112147 (mRNA isoform) |
Refseq ID | XP_001093450 |
Protein GI | 109112147 |
UniProt ID | H9EXG6 |
mRNA ID | XM_001093450 |
Length | 84 |
MATGTDQVVGLGLVAVSLIIFTYYTAWVILLPFIDSEHVIHKYFLPRAYAVAIPLAAGLLLLLFVGLFITYVMLKSERVTKKAQ |
Gene Information
Entrez Gene ID
Gene Name
dolichyl-phosphate mannosyltransferase polypeptide 2, regulatory subunit
Gene Symbol
Species
Macaca mulatta
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0030176 | IEA:InterPro | C | integral component of endoplasmic reticulum membrane |
GO:0009059 | IEA:InterPro | P | macromolecule biosynthetic process |
KEGG Pathway Links
Domain Information
InterPro Annotations
Accession | Description |
---|---|
IPR009914 | Dolichol phosphate-mannose biosynthesis regulatory |
UniProt Annotations
Entry Information
Gene Name
dolichyl-phosphate mannosyltransferase polypeptide 2, regulatory subunit
Protein Entry
H9EXG6_MACMU
UniProt ID
Species
Rhesus monkey
Identical and Related Proteins
Unique RefSeq proteins for LMP014032 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
109112147 | RefSeq | XP_001093450 | 84 | dolichyl-phosphate mannosyltransferase polypeptide 2, regulatory subunit |
Identical Sequences to LMP014032 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:386780604 | GenBank | AFE67075.1 | 84 | dolichol phosphate-mannose biosynthesis regulatory protein [Macaca mulatta] |
GI:386780604 | GenBank | AFH34464.1 | 84 | dolichol phosphate-mannose biosynthesis regulatory protein [Macaca mulatta] |
GI:386780604 | RefSeq | XP_003911957.1 | 84 | PREDICTED: dolichol phosphate-mannose biosynthesis regulatory protein [Papio anubis] |
GI:386780604 | RefSeq | XP_005582197.1 | 84 | PREDICTED: dolichol phosphate-mannose biosynthesis regulatory protein [Macaca fascicularis] |
Related Sequences to LMP014032 proteins
Reference | Database | Accession | Length | Protein Name |
---|