Gene/Proteome Database (LMPD)
LMPD ID
LMP014052
Gene ID
Species
Macaca mulatta (Rhesus monkey)
Gene Name
ELOVL fatty acid elongase 3
Gene Symbol
Alternate Names
elongation of very long chain fatty acids protein 3; elongation of very long chain fatty acids (FEN1/Elo2, SUR4/Elo3, yeast)-like 3;
Chromosome
9
Map Location
chromosome:9
EC Number
2.3.1.199
Proteins
| elongation of very long chain fatty acids protein 3 | |
|---|---|
| Refseq ID | NP_001181481 |
| Protein GI | 302563651 |
| UniProt ID | F7GCP7 |
| mRNA ID | NM_001194552 |
| Length | 270 |
| Protein sequence is identical to GI:109090393 (mRNA isoform) | |
| Refseq ID | XP_001112272 |
| Protein GI | 109090393 |
| UniProt ID | F7GCP7 |
| mRNA ID | XM_001112272 |
| Length | 270 |
| MVTAMNVSHQVNQLFQPCNFELFKDMRPFFEEYWATSFPIALIYLLLIPVGQNYMKERKGFNLQGPLILWSFCLAIFSILGAVRMWGFMGTVILTGGLKQTMCFVNFVGNSTVKFWSWVFLLSKVIELGDTAFIILRKRPLIFIHWYHHSTVLVYTSFGYKNQVPAGGWFVTMNFSVHAFMYTYYTLKAANVKPPKMLPMLITSLQILQMFVGAIVSILAYIWRQEQGCHTTMEHLFWSFILYMTYFILFAHFFRQTYIKPKVKAKTKSQ | |
Gene Information
Entrez Gene ID
Gene Name
ELOVL fatty acid elongase 3
Gene Symbol
Species
Macaca mulatta
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005783 | IEA:Ensembl | C | endoplasmic reticulum |
| GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
| GO:0016740 | IEA:UniProtKB-KW | F | transferase activity |
| GO:0034625 | IEA:Ensembl | P | fatty acid elongation, monounsaturated fatty acid |
| GO:0034626 | IEA:Ensembl | P | fatty acid elongation, polyunsaturated fatty acid |
| GO:0019367 | IEA:Ensembl | P | fatty acid elongation, saturated fatty acid |
| GO:0042761 | IEA:Ensembl | P | very long-chain fatty acid biosynthetic process |
KEGG Pathway Links
Domain Information
InterPro Annotations
| Accession | Description |
|---|---|
| IPR002076 | ELO family |
UniProt Annotations
Entry Information
Gene Name
ELOVL fatty acid elongase 3
Protein Entry
F7GCP7_MACMU
UniProt ID
Species
Rhesus monkey
Comments
| Comment Type | Description |
|---|---|
| Catalytic Activity | A very-long-chain acyl-CoA + malonyl-CoA = CoA + a very-long-chain 3-oxoacyl-CoA + CO(2). |
| Similarity | Belongs to the ELO family. |
Identical and Related Proteins
Unique RefSeq proteins for LMP014052 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 109090393 | RefSeq | XP_001112272 | 270 | ELOVL fatty acid elongase 3 |
Identical Sequences to LMP014052 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:302563651 | GenBank | EHH19327.1 | 270 | hypothetical protein EGK_20010 [Macaca mulatta] |
Related Sequences to LMP014052 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:302563651 | GenBank | EHH64975.1 | 270 | hypothetical protein EGM_18310 [Macaca fascicularis] |
| GI:302563651 | RefSeq | XP_005566337.1 | 270 | PREDICTED: elongation of very long chain fatty acids protein 3 [Macaca fascicularis] |
| GI:302563651 | RefSeq | XP_007962143.1 | 270 | PREDICTED: elongation of very long chain fatty acids protein 3 [Chlorocebus sabaeus] |