Gene/Proteome Database (LMPD)

LMPD ID
LMP014052
Gene ID
Species
Macaca mulatta (Rhesus monkey)
Gene Name
ELOVL fatty acid elongase 3
Gene Symbol
Alternate Names
elongation of very long chain fatty acids protein 3; elongation of very long chain fatty acids (FEN1/Elo2, SUR4/Elo3, yeast)-like 3;
Chromosome
9
Map Location
chromosome:9
EC Number
2.3.1.199

Proteins

elongation of very long chain fatty acids protein 3
Refseq ID NP_001181481
Protein GI 302563651
UniProt ID F7GCP7
mRNA ID NM_001194552
Length 270
Protein sequence is identical to GI:109090393 (mRNA isoform)
Refseq ID XP_001112272
Protein GI 109090393
UniProt ID F7GCP7
mRNA ID XM_001112272
Length 270
MVTAMNVSHQVNQLFQPCNFELFKDMRPFFEEYWATSFPIALIYLLLIPVGQNYMKERKGFNLQGPLILWSFCLAIFSILGAVRMWGFMGTVILTGGLKQTMCFVNFVGNSTVKFWSWVFLLSKVIELGDTAFIILRKRPLIFIHWYHHSTVLVYTSFGYKNQVPAGGWFVTMNFSVHAFMYTYYTLKAANVKPPKMLPMLITSLQILQMFVGAIVSILAYIWRQEQGCHTTMEHLFWSFILYMTYFILFAHFFRQTYIKPKVKAKTKSQ

Gene Information

Entrez Gene ID
Gene Name
ELOVL fatty acid elongase 3
Gene Symbol
Species
Macaca mulatta

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005783 IEA:Ensembl C endoplasmic reticulum
GO:0016021 IEA:UniProtKB-KW C integral component of membrane
GO:0016740 IEA:UniProtKB-KW F transferase activity
GO:0034625 IEA:Ensembl P fatty acid elongation, monounsaturated fatty acid
GO:0034626 IEA:Ensembl P fatty acid elongation, polyunsaturated fatty acid
GO:0019367 IEA:Ensembl P fatty acid elongation, saturated fatty acid
GO:0042761 IEA:Ensembl P very long-chain fatty acid biosynthetic process

KEGG Pathway Links

KEGG Pathway ID Description
ko00062 Fatty acid elongation
mcc00062 Fatty acid elongation

Domain Information

InterPro Annotations

Accession Description
IPR002076 ELO family

UniProt Annotations

Entry Information

Gene Name
ELOVL fatty acid elongase 3
Protein Entry
F7GCP7_MACMU
UniProt ID
Species
Rhesus monkey

Comments

Comment Type Description
Catalytic Activity A very-long-chain acyl-CoA + malonyl-CoA = CoA + a very-long-chain 3-oxoacyl-CoA + CO(2).
Similarity Belongs to the ELO family.

Identical and Related Proteins

Unique RefSeq proteins for LMP014052 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
109090393 RefSeq XP_001112272 270 ELOVL fatty acid elongase 3

Identical Sequences to LMP014052 proteins

Reference Database Accession Length Protein Name
GI:302563651 GenBank EHH19327.1 270 hypothetical protein EGK_20010 [Macaca mulatta]

Related Sequences to LMP014052 proteins

Reference Database Accession Length Protein Name
GI:302563651 GenBank EHH64975.1 270 hypothetical protein EGM_18310 [Macaca fascicularis]
GI:302563651 RefSeq XP_005566337.1 270 PREDICTED: elongation of very long chain fatty acids protein 3 [Macaca fascicularis]
GI:302563651 RefSeq XP_007962143.1 270 PREDICTED: elongation of very long chain fatty acids protein 3 [Chlorocebus sabaeus]