Gene/Proteome Database (LMPD)

LMPD ID
LMP014054
Gene ID
Species
Macaca mulatta (Rhesus monkey)
Gene Name
ELOVL fatty acid elongase 6
Gene Symbol
Alternate Names
elongation of very long chain fatty acids protein 6; ELOVL family member 6, elongation of long chain fatty acids (FEN1/Elo2, SUR4/Elo3-like, yeast);
Chromosome
5
Map Location
chromosome:5
EC Number
2.3.1.199

Proteins

elongation of very long chain fatty acids protein 6
Refseq ID NP_001253850
Protein GI 388454170
UniProt ID G7MTM8
mRNA ID NM_001266921
Length 265
Protein sequence is identical to GI:109075349 (mRNA isoform)
Refseq ID XP_001089527
Protein GI 109075349
UniProt ID G7MTM8
mRNA ID XM_001089527
Length 265
MNMSVLTLQEYEFEKQFNENEAIQWMQENWKKSFLFSALYAAFVFGGRHLMNKRAKFELRKPLVLWSLTLAVFSIFGALRTGAYMVYILMTKGLKQSVCDQGFYNGPVSKFWAYAFVLSKAPELGDTIFIVLRKQKLIFLHWYHHITVLLYSWYSYKDMVAGGGWFMTMNYSVHAVMYSYYALRAAGFRVSRKFAMFITLSQITQMLMGCVINYLVFYWMQHDQCHSHFQNIFWSSLMYLSYLVLFCHFFFEAYIGKMRKTTKAE
Refseq ID XP_001089764
Protein GI 109075353
UniProt ID G7MTM8
mRNA ID XM_001089527
Length 265
Protein sequence is identical to GI:109075349 (mRNA isoform)
Refseq ID XP_001089649
Protein GI 109075351
UniProt ID G7MTM8
mRNA ID XM_001089527
Length 265
Protein sequence is identical to GI:109075349 (mRNA isoform)

Gene Information

Entrez Gene ID
Gene Name
ELOVL fatty acid elongase 6
Gene Symbol
Species
Macaca mulatta

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0016021 IEA:UniProtKB-KW C integral component of membrane
GO:0016740 IEA:UniProtKB-KW F transferase activity
GO:0006633 IEA:UniProtKB-KW P fatty acid biosynthetic process

KEGG Pathway Links

KEGG Pathway ID Description
ko01040 Biosynthesis of unsaturated fatty acids
mcc01040 Biosynthesis of unsaturated fatty acids
ko00062 Fatty acid elongation
mcc00062 Fatty acid elongation
ko01212 Fatty acid metabolism
mcc01212 Fatty acid metabolism
mcc01100 Metabolic pathways

Domain Information

InterPro Annotations

Accession Description
IPR002076 ELO family

UniProt Annotations

Entry Information

Gene Name
ELOVL fatty acid elongase 6
Protein Entry
G7MTM8_MACMU
UniProt ID
Species
Rhesus monkey

Comments

Comment Type Description
Catalytic Activity A very-long-chain acyl-CoA + malonyl-CoA = CoA + a very-long-chain 3-oxoacyl-CoA + CO(2).
Similarity Belongs to the ELO family.

Identical and Related Proteins

Unique RefSeq proteins for LMP014054 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
109075349 RefSeq XP_001089527 265 ELOVL fatty acid elongase 6

Identical Sequences to LMP014054 proteins

Reference Database Accession Length Protein Name
GI:388454170 GenBank AFE66210.1 265 elongation of very long chain fatty acids protein 6 [Macaca mulatta]
GI:388454170 RefSeq XP_005555746.1 265 PREDICTED: elongation of very long chain fatty acids protein 6 [Macaca fascicularis]
GI:388454170 RefSeq XP_007997733.1 265 PREDICTED: elongation of very long chain fatty acids protein 6 [Chlorocebus sabaeus]
GI:388454170 RefSeq XP_007997734.1 265 PREDICTED: elongation of very long chain fatty acids protein 6 [Chlorocebus sabaeus]

Related Sequences to LMP014054 proteins

Reference Database Accession Length Protein Name
GI:388454170 GenBank EHH26124.1 265 hypothetical protein EGK_16016 [Macaca mulatta]