Gene/Proteome Database (LMPD)

LMPD ID
LMP014117
Gene ID
Species
Macaca mulatta (Rhesus monkey)
Gene Name
fucosyltransferase 1 (galactoside 2-alpha-L-fucosyltransferase, H blood group)
Gene Symbol
Alternate Names
galactoside 2-alpha-L-fucosyltransferase 1; alpha (1,2) fucosyl transferase;
Chromosome
19
Map Location
chromosome:19

Proteins

galactoside 2-alpha-L-fucosyltransferase 1 precursor
Refseq ID NP_001040619
Protein GI 114051111
UniProt ID Q9TUD2
mRNA ID NM_001047154
Length 366
MWPPSRRQLCLAFLLVCVLSALSFFLHIHQDSFPHGLRLSILCPDRHLVTSPVAIFCLPGTPVGPNTSSSCPQNSASLSGTWTIYPDGRFGNQMGQYATLLALAQLNGRRAFILPAMHAALAPVFRITLPVLAPEVDSRTPWRELQLHDWMSEEYADLRDPFLKLSGFPCSWTFFHHLREQIRREFTLHDHLREEAQSVLGQLRLGLTGDRPRTFVGVHVRRGDYLQVMPQRWKGVVGDSAYLRQAMDWFRARHEAPVFVVTSNGMEWCKENIDTSQGDVTFAGDGQEATPWKDFALLTQCNHTIMTIGTFGFWAAYLAGGDTVYLANFTLPDSEFLKIFKPEAAFLPEWVGINADLSPLWTLAEP
sig_peptide: 1..23 inference: COORDINATES: ab initio prediction:SignalP:4.0 calculated_mol_wt: 2604 peptide sequence: MWPPSRRQLCLAFLLVCVLSALS

Gene Information

Entrez Gene ID
Gene Name
fucosyltransferase 1 (galactoside 2-alpha-L-fucosyltransferase, H blood group)
Gene Symbol
Species
Macaca mulatta

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0016020 IEA:InterPro C membrane
GO:0008107 IEA:Ensembl F galactoside 2-alpha-L-fucosyltransferase activity

KEGG Pathway Links

KEGG Pathway ID Description
ko00603 Glycosphingolipid biosynthesis - globo series
mcc00603 Glycosphingolipid biosynthesis - globo series
ko00601 Glycosphingolipid biosynthesis - lacto and neolacto series
mcc00601 Glycosphingolipid biosynthesis - lacto and neolacto series
mcc01100 Metabolic pathways

Domain Information

InterPro Annotations

Accession Description
IPR002516 Glycosyl transferase, family 11

UniProt Annotations

Entry Information

Gene Name
fucosyltransferase 1 (galactoside 2-alpha-L-fucosyltransferase, H blood group)
Protein Entry
Q9TUD2_MACMU
UniProt ID
Species
Rhesus monkey

Identical and Related Proteins

Unique RefSeq proteins for LMP014117 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
114051111 RefSeq NP_001040619 366 galactoside 2-alpha-L-fucosyltransferase 1 precursor

Identical Sequences to LMP014117 proteins

Reference Database Accession Length Protein Name
GI:114051111 GenBank AAF14069.1 366 alpha (1,2) fucosyl transferase [Macaca mulatta]
GI:114051111 GenBank EHH30234.1 366 hypothetical protein EGK_10854 [Macaca mulatta]

Related Sequences to LMP014117 proteins

Reference Database Accession Length Protein Name
GI:114051111 GenBank EHH59756.1 366 hypothetical protein EGM_09946 [Macaca fascicularis]
GI:114051111 RefSeq XP_005589864.1 366 PREDICTED: galactoside 2-alpha-L-fucosyltransferase 1 isoform X2 [Macaca fascicularis]