Gene/Proteome Database (LMPD)

LMPD ID
LMP014127
Gene ID
Species
Macaca mulatta (Rhesus monkey)
Gene Name
galactosylceramidase
Gene Symbol
Alternate Names
galactocerebrosidase; GALCERase; galactocerebroside beta-galactosidase; galactosylceramide beta-galactosidase;
Chromosome
7
Map Location
chromosome:7
EC Number
3.2.1.46

Proteins

galactocerebrosidase precursor
Refseq ID NP_001037727
Protein GI 112982788
UniProt ID O02791
mRNA ID NM_001044262
Length 669
MTAAAGSAGRAAVPFLLCALLAPGGAYVLDDSDGLGREFDGIGAVSGGGATSRLLVNYPEPYRSQILDYLFKPNFGASLHILKVEIGGDGQTTDGTEPSHMHYALDENYFRGYEWWLMKEAKKRNPNITLIGLPWSFPGWLGKGFDWPYVNLQLTAYYVVTWIVGAKRYHDLDIDYIGIWNERSYNANYIKILRKMLNSQGLQRVKIIASDNLWESISAAMLLDAELFKVVDVIGAHYPGTHSVKDARLTGKKLWSSEDFSTLNSDTGAGCWGRILNQNYVNGYMTSTIAWNLVASYYEQLPYGRCGLMTAQEPWSGHYVVESPVWVSAHTTQFTQPGWYYLKTVGHLEKGGSYVALTDGLGNLTIIIETMSHKHSKCIRPFLPYFNVSQQFATFVLKGSFSEIPELQVWYTKLGKTSERFLFKQLDSLWLLDSNGSFTLKLQEDELFTLTTLTTGRKGSYLPPPKSQRFPSTYKDDFNVDYPFFSEAPNFADQTGVFEYFTNMEDPGEHHFTLRQVLNQRPITWAADASNTISIIGDYNWTNLTIKCDVYIETPDTGGVFIAGRVNKGGILIRSARGIFFWIFANGSYRVTGDLAGWIIYALGHVEVTAKTWYTLTLTIKGRFASGMLNDKSLWTDIPVNFPKNGWAAIGTHSFEFAQFDNFHVEATR
sig_peptide: 1..26 inference: COORDINATES: ab initio prediction:SignalP:4.0 calculated_mol_wt: 2358 peptide sequence: MTAAAGSAGRAAVPFLLCALLAPGGA

Gene Information

Entrez Gene ID
Gene Name
galactosylceramidase
Gene Symbol
Species
Macaca mulatta

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005764 IEA:UniProtKB-KW C lysosome
GO:0005739 IEA:Ensembl C mitochondrion
GO:0004336 ISS:UniProtKB F galactosylceramidase activity
GO:0005975 IEA:InterPro P carbohydrate metabolic process
GO:0006683 ISS:UniProtKB P galactosylceramide catabolic process

KEGG Pathway Links

KEGG Pathway ID Description
ko04142 Lysosome
mcc04142 Lysosome
mcc01100 Metabolic pathways
ko00600 Sphingolipid metabolism
mcc00600 Sphingolipid metabolism

Domain Information

InterPro Annotations

Accession Description
IPR017853 Glycoside hydrolase superfamily
IPR013781 Glycoside hydrolase, catalytic domain
IPR001286 Glycoside hydrolase, family 59

UniProt Annotations

Entry Information

Gene Name
galactosylceramidase
Protein Entry
GALC_MACMU
UniProt ID
Species
Rhesus monkey

Comments

Comment Type Description
Catalytic Activity D-galactosyl-N-acylsphingosine + H(2)O = D- galactose + N-acylsphingosine.
Caution It is uncertain whether Met-1 or Met-17 is the initiator.
Disease Note=Defects in GALC are the cause of globoid cell leukodystrophy (GLD); also known as Krabbe disease. This deficiency results in the insufficient catabolism of several galactolipids that are important in the production of normal myelin.
Function Hydrolyzes the galactose ester bonds of galactosylceramide, galactosylsphingosine, lactosylceramide, and monogalactosyldiglyceride. Enzyme with very low activity responsible for the lysosomal catabolism of galactosylceramide, a major lipid in myelin, kidney and epithelial cells of small intestine and colon.
Sequence Caution Sequence=AAB58575.1; Type=Erroneous initiation; Evidence= ;
Similarity Belongs to the glycosyl hydrolase 59 family.
Subcellular Location Lysosome

Identical and Related Proteins

Unique RefSeq proteins for LMP014127 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
112982788 RefSeq NP_001037727 669 galactocerebrosidase precursor

Identical Sequences to LMP014127 proteins

Reference Database Accession Length Protein Name
GI:112982788 GenBank AAB58575.1 669 galactocerebrosidase [Macaca mulatta]
GI:112982788 GenBank AAB58576.1 669 galactocerebrosidase [Macaca mulatta]

Related Sequences to LMP014127 proteins

Reference Database Accession Length Protein Name
GI:112982788 RefSeq XP_005562021.1 685 PREDICTED: galactocerebrosidase isoform X1 [Macaca fascicularis]
GI:112982788 SwissProt O02791.2 685 RecName: Full=Galactocerebrosidase; Short=GALCERase; AltName: Full=Galactocerebroside beta-galactosidase; AltName: Full=Galactosylceramidase; AltName: Full=Galactosylceramide beta-galactosidase; Flags: Precursor [Macaca mulatta]