Gene/Proteome Database (LMPD)
LMPD ID
LMP014127
Gene ID
Species
Macaca mulatta (Rhesus monkey)
Gene Name
galactosylceramidase
Gene Symbol
Alternate Names
galactocerebrosidase; GALCERase; galactocerebroside beta-galactosidase; galactosylceramide beta-galactosidase;
Chromosome
7
Map Location
chromosome:7
EC Number
3.2.1.46
Proteins
galactocerebrosidase precursor | |
---|---|
Refseq ID | NP_001037727 |
Protein GI | 112982788 |
UniProt ID | O02791 |
mRNA ID | NM_001044262 |
Length | 669 |
MTAAAGSAGRAAVPFLLCALLAPGGAYVLDDSDGLGREFDGIGAVSGGGATSRLLVNYPEPYRSQILDYLFKPNFGASLHILKVEIGGDGQTTDGTEPSHMHYALDENYFRGYEWWLMKEAKKRNPNITLIGLPWSFPGWLGKGFDWPYVNLQLTAYYVVTWIVGAKRYHDLDIDYIGIWNERSYNANYIKILRKMLNSQGLQRVKIIASDNLWESISAAMLLDAELFKVVDVIGAHYPGTHSVKDARLTGKKLWSSEDFSTLNSDTGAGCWGRILNQNYVNGYMTSTIAWNLVASYYEQLPYGRCGLMTAQEPWSGHYVVESPVWVSAHTTQFTQPGWYYLKTVGHLEKGGSYVALTDGLGNLTIIIETMSHKHSKCIRPFLPYFNVSQQFATFVLKGSFSEIPELQVWYTKLGKTSERFLFKQLDSLWLLDSNGSFTLKLQEDELFTLTTLTTGRKGSYLPPPKSQRFPSTYKDDFNVDYPFFSEAPNFADQTGVFEYFTNMEDPGEHHFTLRQVLNQRPITWAADASNTISIIGDYNWTNLTIKCDVYIETPDTGGVFIAGRVNKGGILIRSARGIFFWIFANGSYRVTGDLAGWIIYALGHVEVTAKTWYTLTLTIKGRFASGMLNDKSLWTDIPVNFPKNGWAAIGTHSFEFAQFDNFHVEATR | |
sig_peptide: 1..26 inference: COORDINATES: ab initio prediction:SignalP:4.0 calculated_mol_wt: 2358 peptide sequence: MTAAAGSAGRAAVPFLLCALLAPGGA |
Gene Information
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0005764 | IEA:UniProtKB-KW | C | lysosome |
GO:0005739 | IEA:Ensembl | C | mitochondrion |
GO:0004336 | ISS:UniProtKB | F | galactosylceramidase activity |
GO:0005975 | IEA:InterPro | P | carbohydrate metabolic process |
GO:0006683 | ISS:UniProtKB | P | galactosylceramide catabolic process |
KEGG Pathway Links
Domain Information
UniProt Annotations
Entry Information
Comments
Comment Type | Description |
---|---|
Catalytic Activity | D-galactosyl-N-acylsphingosine + H(2)O = D- galactose + N-acylsphingosine. |
Caution | It is uncertain whether Met-1 or Met-17 is the initiator. |
Disease | Note=Defects in GALC are the cause of globoid cell leukodystrophy (GLD); also known as Krabbe disease. This deficiency results in the insufficient catabolism of several galactolipids that are important in the production of normal myelin. |
Function | Hydrolyzes the galactose ester bonds of galactosylceramide, galactosylsphingosine, lactosylceramide, and monogalactosyldiglyceride. Enzyme with very low activity responsible for the lysosomal catabolism of galactosylceramide, a major lipid in myelin, kidney and epithelial cells of small intestine and colon. |
Sequence Caution | Sequence=AAB58575.1; Type=Erroneous initiation; Evidence= ; |
Similarity | Belongs to the glycosyl hydrolase 59 family. |
Subcellular Location | Lysosome |
Identical and Related Proteins
Unique RefSeq proteins for LMP014127 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
112982788 | RefSeq | NP_001037727 | 669 | galactocerebrosidase precursor |
Identical Sequences to LMP014127 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:112982788 | GenBank | AAB58575.1 | 669 | galactocerebrosidase [Macaca mulatta] |
GI:112982788 | GenBank | AAB58576.1 | 669 | galactocerebrosidase [Macaca mulatta] |
Related Sequences to LMP014127 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:112982788 | RefSeq | XP_005562021.1 | 685 | PREDICTED: galactocerebrosidase isoform X1 [Macaca fascicularis] |
GI:112982788 | SwissProt | O02791.2 | 685 | RecName: Full=Galactocerebrosidase; Short=GALCERase; AltName: Full=Galactocerebroside beta-galactosidase; AltName: Full=Galactosylceramidase; AltName: Full=Galactosylceramide beta-galactosidase; Flags: Precursor [Macaca mulatta] |