Gene/Proteome Database (LMPD)

LMPD ID
LMP014135
Gene ID
Species
Macaca mulatta (Rhesus monkey)
Gene Name
glucosaminyl (N-acetyl) transferase 3, mucin type
Gene Symbol
Alternate Names
beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3;
Chromosome
7
Map Location
chromosome:7

Proteins

beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3
Refseq ID NP_001181063
Protein GI 302564594
UniProt ID F7HH43
mRNA ID NM_001194134
Length 438
Protein sequence is identical to GI:109081336 (mRNA isoform)
Refseq ID XP_001099658
Protein GI 109081336
UniProt ID F7HH43
mRNA ID XM_001099658
Length 438
MVQWKRLCRQHYLWALGCYMLLAIVALKLSLRLKCDSDHLGLESREFQSQYCRNILYNSLKLPAKRSINCSGITRGDPEAVFQAILNNLEVKKKREPFTDTHYLSLTRDCERFKAERKFIQFPLSKEEVDFPIAYSMVIHEKIENFERLLRAVYAPQNIYCIHVDEKSPETFKEAVKAIISCFPNVFIASKLVRVIYASWSRVQADLNCMEDLLQSSVPWRYFLNTCGTDFPLKSNAEMVQALKMLNGRNSMETEVPPKHKQTRWEYHFEVVGDTLHLTNKKKDPPPYNLTMFTGNAYIVASRDFVQHVLKNPKSRQLIEWVKDTYSPDEHLWATLQRARWMPGSVPNHPKYDISDMTSIARLVKWQDHEGDIDKGAPYAPCSGIHQRAVCVYGAGDLHWMLQNHHLLANKFDPKVDDNALQCLEEYLRYKAIYGTEL

Gene Information

Entrez Gene ID
Gene Name
glucosaminyl (N-acetyl) transferase 3, mucin type
Gene Symbol
Species
Macaca mulatta

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0070062 IEA:Ensembl C extracellular vesicular exosome
GO:0016020 IEA:InterPro C membrane
GO:0047225 IEA:Ensembl F acetylgalactosaminyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase activity
GO:0002426 IEA:Ensembl P immunoglobulin production in mucosal tissue
GO:0050892 IEA:Ensembl P intestinal absorption
GO:0060993 IEA:Ensembl P kidney morphogenesis
GO:0048729 IEA:Ensembl P tissue morphogenesis

KEGG Pathway Links

KEGG Pathway ID Description
mcc01100 Metabolic pathways
ko00512 Mucin type O-Glycan biosynthesis
mcc00512 Mucin type O-Glycan biosynthesis
M00056 O-glycan biosynthesis, mucin type core
mcc_M00056 O-glycan biosynthesis, mucin type core

Domain Information

InterPro Annotations

Accession Description
IPR003406 Glycosyl transferase, family 14

UniProt Annotations

Entry Information

Gene Name
glucosaminyl (N-acetyl) transferase 3, mucin type
Protein Entry
F7HH43_MACMU
UniProt ID
Species
Rhesus monkey

Identical and Related Proteins

Unique RefSeq proteins for LMP014135 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
109081336 RefSeq XP_001099658 438 glucosaminyl (N-acetyl) transferase 3, mucin type

Identical Sequences to LMP014135 proteins

Reference Database Accession Length Protein Name

Related Sequences to LMP014135 proteins

Reference Database Accession Length Protein Name
GI:302564594 GenBank EHH63118.1 438 Beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 [Macaca fascicularis]
GI:302564594 RefSeq XP_005559738.1 438 PREDICTED: beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 isoform X1 [Macaca fascicularis]
GI:302564594 RefSeq XP_005559739.1 438 PREDICTED: beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 isoform X2 [Macaca fascicularis]
GI:302564594 RefSeq XP_005559740.1 438 PREDICTED: beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 isoform X3 [Macaca fascicularis]