Gene/Proteome Database (LMPD)
Proteins
beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 | |
---|---|
Refseq ID | NP_001181063 |
Protein GI | 302564594 |
UniProt ID | F7HH43 |
mRNA ID | NM_001194134 |
Length | 438 |
Protein sequence is identical to GI:109081336 (mRNA isoform) |
Refseq ID | XP_001099658 |
Protein GI | 109081336 |
UniProt ID | F7HH43 |
mRNA ID | XM_001099658 |
Length | 438 |
MVQWKRLCRQHYLWALGCYMLLAIVALKLSLRLKCDSDHLGLESREFQSQYCRNILYNSLKLPAKRSINCSGITRGDPEAVFQAILNNLEVKKKREPFTDTHYLSLTRDCERFKAERKFIQFPLSKEEVDFPIAYSMVIHEKIENFERLLRAVYAPQNIYCIHVDEKSPETFKEAVKAIISCFPNVFIASKLVRVIYASWSRVQADLNCMEDLLQSSVPWRYFLNTCGTDFPLKSNAEMVQALKMLNGRNSMETEVPPKHKQTRWEYHFEVVGDTLHLTNKKKDPPPYNLTMFTGNAYIVASRDFVQHVLKNPKSRQLIEWVKDTYSPDEHLWATLQRARWMPGSVPNHPKYDISDMTSIARLVKWQDHEGDIDKGAPYAPCSGIHQRAVCVYGAGDLHWMLQNHHLLANKFDPKVDDNALQCLEEYLRYKAIYGTEL |
Gene Information
Entrez Gene ID
Gene Name
glucosaminyl (N-acetyl) transferase 3, mucin type
Gene Symbol
Species
Macaca mulatta
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0070062 | IEA:Ensembl | C | extracellular vesicular exosome |
GO:0016020 | IEA:InterPro | C | membrane |
GO:0047225 | IEA:Ensembl | F | acetylgalactosaminyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase activity |
GO:0002426 | IEA:Ensembl | P | immunoglobulin production in mucosal tissue |
GO:0050892 | IEA:Ensembl | P | intestinal absorption |
GO:0060993 | IEA:Ensembl | P | kidney morphogenesis |
GO:0048729 | IEA:Ensembl | P | tissue morphogenesis |
KEGG Pathway Links
KEGG Pathway ID | Description |
---|---|
mcc01100 | Metabolic pathways |
ko00512 | Mucin type O-Glycan biosynthesis |
mcc00512 | Mucin type O-Glycan biosynthesis |
M00056 | O-glycan biosynthesis, mucin type core |
mcc_M00056 | O-glycan biosynthesis, mucin type core |
Domain Information
InterPro Annotations
Accession | Description |
---|---|
IPR003406 | Glycosyl transferase, family 14 |
UniProt Annotations
Entry Information
Gene Name
glucosaminyl (N-acetyl) transferase 3, mucin type
Protein Entry
F7HH43_MACMU
UniProt ID
Species
Rhesus monkey
Identical and Related Proteins
Unique RefSeq proteins for LMP014135 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
109081336 | RefSeq | XP_001099658 | 438 | glucosaminyl (N-acetyl) transferase 3, mucin type |
Identical Sequences to LMP014135 proteins
Reference | Database | Accession | Length | Protein Name |
---|
Related Sequences to LMP014135 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:302564594 | GenBank | EHH63118.1 | 438 | Beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 [Macaca fascicularis] |
GI:302564594 | RefSeq | XP_005559738.1 | 438 | PREDICTED: beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 isoform X1 [Macaca fascicularis] |
GI:302564594 | RefSeq | XP_005559739.1 | 438 | PREDICTED: beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 isoform X2 [Macaca fascicularis] |
GI:302564594 | RefSeq | XP_005559740.1 | 438 | PREDICTED: beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 isoform X3 [Macaca fascicularis] |