Gene/Proteome Database (LMPD)
Proteins
glutathione peroxidase 1 | |
---|---|
Refseq ID | NP_001152770 |
Protein GI | 226531023 |
mRNA ID | NM_001159298 |
Length | 198 |
MCAARLAAAAVYAFSARPLAGGEPVSLGSLRGKVLLIENVASLUGTTVRDYTQMNELQRRLGPRGLVVLGFPCNQFGHQENAKNEEILNSLKYVRPGGGFEPNFMLFEKCEVNGAGAHPLFAFLREALPAPSDDATALMTDPKLITWSPVCRNDVAWNFEKFLVGPDGVPVRRYSRRFQTIDIEPDIEALLSQGPSSA |
Gene Information
Domain Information
InterPro Annotations
Accession | Description |
---|
UniProt Annotations
Entry Information
Gene Name
glutathione peroxidase 1
Species
Rhesus monkey
Identical and Related Proteins
Unique RefSeq proteins for LMP014187 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
226531023 | RefSeq | NP_001152770 | 198 | glutathione peroxidase 1 |
Identical Sequences to LMP014187 proteins
Reference | Database | Accession | Length | Protein Name |
---|
Related Sequences to LMP014187 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:226531023 | RefSeq | XP_005547163.1 | 198 | PREDICTED: LOW QUALITY PROTEIN: glutathione peroxidase 1 [Macaca fascicularis] |
GI:226531023 | RefSeq | XP_007982412.1 | 201 | PREDICTED: LOW QUALITY PROTEIN: glutathione peroxidase 1 [Chlorocebus sabaeus] |
GI:226531023 | RefSeq | XP_003894478.2 | 198 | PREDICTED: LOW QUALITY PROTEIN: glutathione peroxidase 1 [Papio anubis] |
GI:226531023 | RefSeq | XP_009190418.1 | 198 | PREDICTED: LOW QUALITY PROTEIN: glutathione peroxidase 1-like [Papio anubis] |