Gene/Proteome Database (LMPD)
Proteins
| glutathione peroxidase 1 | |
|---|---|
| Refseq ID | NP_001152770 |
| Protein GI | 226531023 |
| mRNA ID | NM_001159298 |
| Length | 198 |
| MCAARLAAAAVYAFSARPLAGGEPVSLGSLRGKVLLIENVASLUGTTVRDYTQMNELQRRLGPRGLVVLGFPCNQFGHQENAKNEEILNSLKYVRPGGGFEPNFMLFEKCEVNGAGAHPLFAFLREALPAPSDDATALMTDPKLITWSPVCRNDVAWNFEKFLVGPDGVPVRRYSRRFQTIDIEPDIEALLSQGPSSA | |
Gene Information
Domain Information
InterPro Annotations
| Accession | Description |
|---|
UniProt Annotations
Entry Information
Gene Name
glutathione peroxidase 1
Species
Rhesus monkey
Identical and Related Proteins
Unique RefSeq proteins for LMP014187 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 226531023 | RefSeq | NP_001152770 | 198 | glutathione peroxidase 1 |
Identical Sequences to LMP014187 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|
Related Sequences to LMP014187 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:226531023 | RefSeq | XP_005547163.1 | 198 | PREDICTED: LOW QUALITY PROTEIN: glutathione peroxidase 1 [Macaca fascicularis] |
| GI:226531023 | RefSeq | XP_007982412.1 | 201 | PREDICTED: LOW QUALITY PROTEIN: glutathione peroxidase 1 [Chlorocebus sabaeus] |
| GI:226531023 | RefSeq | XP_003894478.2 | 198 | PREDICTED: LOW QUALITY PROTEIN: glutathione peroxidase 1 [Papio anubis] |
| GI:226531023 | RefSeq | XP_009190418.1 | 198 | PREDICTED: LOW QUALITY PROTEIN: glutathione peroxidase 1-like [Papio anubis] |