Gene/Proteome Database (LMPD)
Proteins
glutathione peroxidase 2 | |
---|---|
Refseq ID | NP_001108609 |
Protein GI | 169636445 |
mRNA ID | NM_001115137 |
Length | 190 |
MAFIAKSFYGVSAISLDGEKVDFNTFRGRAVLIENVASLUGTTTRDFTQLNELQCRFPRRLVVLGFPCNQFGHQENCQNEEILNSLKYVRPGGGYQPTFTLVQKCEVNGQNEHPVFAYLKDKLPYPHDDPFSLMTDPKLIIWSPVRRSDVAWNFEKFLIGPEGEPFRRYSRTFPTINIEPDIKRLLKVAI |
Gene Information
Domain Information
InterPro Annotations
Accession | Description |
---|
UniProt Annotations
Entry Information
Gene Name
glutathione peroxidase 2 (gastrointestinal)
Species
Rhesus monkey
Identical and Related Proteins
Unique RefSeq proteins for LMP014188 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
169636445 | RefSeq | NP_001108609 | 190 | glutathione peroxidase 2 |
Identical Sequences to LMP014188 proteins
Reference | Database | Accession | Length | Protein Name |
---|
Related Sequences to LMP014188 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:169636445 | RefSeq | XP_003901982.1 | 190 | PREDICTED: LOW QUALITY PROTEIN: glutathione peroxidase 2 [Papio anubis] |
GI:169636445 | RefSeq | XP_005561547.1 | 190 | PREDICTED: LOW QUALITY PROTEIN: glutathione peroxidase 2 [Macaca fascicularis] |
GI:169636445 | RefSeq | XP_007985167.1 | 190 | PREDICTED: LOW QUALITY PROTEIN: glutathione peroxidase 2 [Chlorocebus sabaeus] |
GI:169636445 | RefSeq | XP_010382009.1 | 190 | PREDICTED: LOW QUALITY PROTEIN: glutathione peroxidase 2 [Rhinopithecus roxellana] |