Gene/Proteome Database (LMPD)
Proteins
| glutathione peroxidase 2 | |
|---|---|
| Refseq ID | NP_001108609 |
| Protein GI | 169636445 |
| mRNA ID | NM_001115137 |
| Length | 190 |
| MAFIAKSFYGVSAISLDGEKVDFNTFRGRAVLIENVASLUGTTTRDFTQLNELQCRFPRRLVVLGFPCNQFGHQENCQNEEILNSLKYVRPGGGYQPTFTLVQKCEVNGQNEHPVFAYLKDKLPYPHDDPFSLMTDPKLIIWSPVRRSDVAWNFEKFLIGPEGEPFRRYSRTFPTINIEPDIKRLLKVAI | |
Gene Information
Domain Information
InterPro Annotations
| Accession | Description |
|---|
UniProt Annotations
Entry Information
Gene Name
glutathione peroxidase 2 (gastrointestinal)
Species
Rhesus monkey
Identical and Related Proteins
Unique RefSeq proteins for LMP014188 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 169636445 | RefSeq | NP_001108609 | 190 | glutathione peroxidase 2 |
Identical Sequences to LMP014188 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|
Related Sequences to LMP014188 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:169636445 | RefSeq | XP_003901982.1 | 190 | PREDICTED: LOW QUALITY PROTEIN: glutathione peroxidase 2 [Papio anubis] |
| GI:169636445 | RefSeq | XP_005561547.1 | 190 | PREDICTED: LOW QUALITY PROTEIN: glutathione peroxidase 2 [Macaca fascicularis] |
| GI:169636445 | RefSeq | XP_007985167.1 | 190 | PREDICTED: LOW QUALITY PROTEIN: glutathione peroxidase 2 [Chlorocebus sabaeus] |
| GI:169636445 | RefSeq | XP_010382009.1 | 190 | PREDICTED: LOW QUALITY PROTEIN: glutathione peroxidase 2 [Rhinopithecus roxellana] |