Gene/Proteome Database (LMPD)
LMPD ID
LMP014238
Gene ID
Species
Macaca mulatta (Rhesus monkey)
Gene Name
hydroxy-delta-5-steroid dehydrogenase, 3 beta- and steroid delta-isomerase 1
Gene Symbol
Alternate Names
hydroxy-delta-5-steroid dehydrogenase, 3 beta- and steroid delta-isomerase 1;
Chromosome
1
Map Location
chromosome:1
Proteins
| Refseq ID | XP_001113873 |
| Protein GI | 109014676 |
| UniProt ID | F7HT16 |
| mRNA ID | XM_001113873 |
| Length | 373 |
| MTGWSCLVTGAGGFLGQRIIRLLVEEKELKEIRVLDKAFRPELREEFSKLQNKTKLTVLEGDILDEPFLKRACQDISVVIHTACIIDVFGVTHRESVMNVNVKGTQLLLEACVQASVPVFIYTSSIEVAGPNSYKEIIQNGHEEEPLENTWSAPYPYSKKLAEKAVLAADGWTLKDGGTLYTCALRPTYIYGEGSQFLSAGINEALNNNGILSSIGKFSTVNPVYVGNVAWAHILALRALRNPKKAPSVRGQFYYISDDTPHQSYDNLSYTLSKEFGLRLDSRWSFPLALMYWIGFLLEIVSFLLRPIYTYRPPFNRHMVTLSNSVFTFSYKKAQRDLAYEPLYSWEEAKQKTVEWVGSLVDRHKETLKSKTQ | |
Gene Information
Entrez Gene ID
Gene Name
hydroxy-delta-5-steroid dehydrogenase, 3 beta- and steroid delta-isomerase 1
Gene Symbol
Species
Macaca mulatta
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0003854 | IEA:InterPro | F | 3-beta-hydroxy-delta5-steroid dehydrogenase activity |
| GO:0006694 | IEA:InterPro | P | steroid biosynthetic process |
KEGG Pathway Links
| KEGG Pathway ID | Description |
|---|---|
| M00110 | C19/C18-Steroid hormone biosynthesis, pregnenolone => androstenedione => estrone |
| mcc_M00110 | C19/C18-Steroid hormone biosynthesis, pregnenolone => androstenedione => estrone |
| mcc01100 | Metabolic pathways |
| ko04913 | Ovarian steroidogenesis |
| mcc04913 | Ovarian steroidogenesis |
| ko00140 | Steroid hormone biosynthesis |
| mcc00140 | Steroid hormone biosynthesis |
| M00107 | Steroid hormone biosynthesis, cholesterol => prognenolone => progesterone |
| mcc_M00107 | Steroid hormone biosynthesis, cholesterol => prognenolone => progesterone |
Domain Information
UniProt Annotations
Entry Information
Gene Name
hydroxy-delta-5-steroid dehydrogenase, 3 beta- and steroid delta-isomerase 1
Protein Entry
F7HT16_MACMU
UniProt ID
Species
Rhesus monkey
Comments
| Comment Type | Description |
|---|---|
| Caution | The sequence shown here is derived from an Ensembl automatic analysis pipeline and should be considered as preliminary data. |
| Similarity | Belongs to the 3-beta-HSD family. |
Identical and Related Proteins
Unique RefSeq proteins for LMP014238 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 109014676 | RefSeq | XP_001113873 | 373 | hydroxy-delta-5-steroid dehydrogenase, 3 beta- and steroid delta-isomerase 1 |
Identical Sequences to LMP014238 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|
Related Sequences to LMP014238 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:109014676 | RefSeq | XP_003892539.1 | 373 | PREDICTED: 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 1 [Papio anubis] |
| GI:109014676 | RefSeq | XP_005542213.1 | 373 | PREDICTED: 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 1-like [Macaca fascicularis] |
| GI:109014676 | RefSeq | XP_007975560.1 | 454 | PREDICTED: 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 1 [Chlorocebus sabaeus] |
| GI:109014676 | RefSeq | XP_010352116.1 | 373 | PREDICTED: 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 1 [Rhinopithecus roxellana] |