Gene/Proteome Database (LMPD)
Proteins
| Refseq ID | XP_001093577 |
| Protein GI | 109123226 |
| UniProt ID | F6V9L6 |
| mRNA ID | XM_001093577 |
| Length | 394 |
| MLSSFNEWLWQHRFWLPPNVTWAELEDRDGRVYPHPQDMLAALPLALVLLAMRLAFERFIGLPLSQWLGVRDQTRRQVKPNATLEKHFLTEGHRPKEPQLSLLAARCGLTLRQTQRWFRRRRKQDRPQLTKKFCEASWRFLFYLSSFVGGLSVLYHESWLWAPVMCWENYPNQTLKPSLYWWYLLELAFYLSLLIRLPFDVKRKDFKEQVIHHFVVVILMTFSYSANLLRIGSLVLLLHDSADYLLEACKMVNYTQYQHVCDALFLIFSLVFFYTRLVLFPTQILYTTYYESLGNRGPFFGYYFCNGLLMLLQLLHVFWSCLILRMLCSFIKKGQMEKDIRSDVEESDSSEEEEAGAQEPLQLKNGAARGPRPAPTDGLRSRVAGRLTRHTTAT | |
Gene Information
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005783 | IEA:Ensembl | C | endoplasmic reticulum |
| GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
| GO:0005634 | IEA:UniProtKB-SubCell | C | nucleus |
| GO:0003677 | IEA:UniProtKB-KW | F | DNA binding |
| GO:0050291 | IEA:Ensembl | F | sphingosine N-acyltransferase activity |
| GO:0046513 | IEA:Ensembl | P | ceramide biosynthetic process |
KEGG Pathway Links
| KEGG Pathway ID | Description |
|---|---|
| M00094 | Ceramide biosynthesis |
| mcc_M00094 | Ceramide biosynthesis |
| mcc01100 | Metabolic pathways |
| ko00600 | Sphingolipid metabolism |
| mcc00600 | Sphingolipid metabolism |
| M00099 | Sphingosine biosynthesis |
| mcc_M00099 | Sphingosine biosynthesis |
Domain Information
UniProt Annotations
Entry Information
Comments
| Comment Type | Description |
|---|---|
| Caution | The sequence shown here is derived from an Ensembl automatic analysis pipeline and should be considered as preliminary data. |
| Similarity | Contains TLC (TRAM/LAG1/CLN8) domain. |
| Subcellular Location | Nucleus |
Identical and Related Proteins
Unique RefSeq proteins for LMP014289 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 109123226 | RefSeq | XP_001093577 | 394 | ceramide synthase 4 |
Identical Sequences to LMP014289 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|
Related Sequences to LMP014289 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:109123226 | RefSeq | XP_009198145.1 | 394 | PREDICTED: ceramide synthase 4 [Papio anubis] |
| GI:109123226 | RefSeq | XP_009198146.1 | 394 | PREDICTED: ceramide synthase 4 [Papio anubis] |
| GI:109123226 | RefSeq | XP_009198148.1 | 394 | PREDICTED: ceramide synthase 4 [Papio anubis] |
| GI:109123226 | RefSeq | XP_009198149.1 | 394 | PREDICTED: ceramide synthase 4 [Papio anubis] |