Gene/Proteome Database (LMPD)
Proteins
Refseq ID | XP_001093577 |
Protein GI | 109123226 |
UniProt ID | F6V9L6 |
mRNA ID | XM_001093577 |
Length | 394 |
MLSSFNEWLWQHRFWLPPNVTWAELEDRDGRVYPHPQDMLAALPLALVLLAMRLAFERFIGLPLSQWLGVRDQTRRQVKPNATLEKHFLTEGHRPKEPQLSLLAARCGLTLRQTQRWFRRRRKQDRPQLTKKFCEASWRFLFYLSSFVGGLSVLYHESWLWAPVMCWENYPNQTLKPSLYWWYLLELAFYLSLLIRLPFDVKRKDFKEQVIHHFVVVILMTFSYSANLLRIGSLVLLLHDSADYLLEACKMVNYTQYQHVCDALFLIFSLVFFYTRLVLFPTQILYTTYYESLGNRGPFFGYYFCNGLLMLLQLLHVFWSCLILRMLCSFIKKGQMEKDIRSDVEESDSSEEEEAGAQEPLQLKNGAARGPRPAPTDGLRSRVAGRLTRHTTAT |
Gene Information
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0005783 | IEA:Ensembl | C | endoplasmic reticulum |
GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
GO:0005634 | IEA:UniProtKB-SubCell | C | nucleus |
GO:0003677 | IEA:UniProtKB-KW | F | DNA binding |
GO:0050291 | IEA:Ensembl | F | sphingosine N-acyltransferase activity |
GO:0046513 | IEA:Ensembl | P | ceramide biosynthetic process |
KEGG Pathway Links
KEGG Pathway ID | Description |
---|---|
M00094 | Ceramide biosynthesis |
mcc_M00094 | Ceramide biosynthesis |
mcc01100 | Metabolic pathways |
ko00600 | Sphingolipid metabolism |
mcc00600 | Sphingolipid metabolism |
M00099 | Sphingosine biosynthesis |
mcc_M00099 | Sphingosine biosynthesis |
Domain Information
UniProt Annotations
Entry Information
Comments
Comment Type | Description |
---|---|
Caution | The sequence shown here is derived from an Ensembl automatic analysis pipeline and should be considered as preliminary data. |
Similarity | Contains TLC (TRAM/LAG1/CLN8) domain. |
Subcellular Location | Nucleus |
Identical and Related Proteins
Unique RefSeq proteins for LMP014289 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
109123226 | RefSeq | XP_001093577 | 394 | ceramide synthase 4 |
Identical Sequences to LMP014289 proteins
Reference | Database | Accession | Length | Protein Name |
---|
Related Sequences to LMP014289 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:109123226 | RefSeq | XP_009198145.1 | 394 | PREDICTED: ceramide synthase 4 [Papio anubis] |
GI:109123226 | RefSeq | XP_009198146.1 | 394 | PREDICTED: ceramide synthase 4 [Papio anubis] |
GI:109123226 | RefSeq | XP_009198148.1 | 394 | PREDICTED: ceramide synthase 4 [Papio anubis] |
GI:109123226 | RefSeq | XP_009198149.1 | 394 | PREDICTED: ceramide synthase 4 [Papio anubis] |