Gene/Proteome Database (LMPD)

LMPD ID
LMP014289
Gene ID
Species
Macaca mulatta (Rhesus monkey)
Gene Name
ceramide synthase 4
Gene Symbol
Alternate Names
ceramide synthase 4; LAG1 homolog, ceramide synthase 4;
Chromosome
19
Map Location
chromosome:19

Proteins

Refseq ID XP_001093577
Protein GI 109123226
UniProt ID F6V9L6
mRNA ID XM_001093577
Length 394
MLSSFNEWLWQHRFWLPPNVTWAELEDRDGRVYPHPQDMLAALPLALVLLAMRLAFERFIGLPLSQWLGVRDQTRRQVKPNATLEKHFLTEGHRPKEPQLSLLAARCGLTLRQTQRWFRRRRKQDRPQLTKKFCEASWRFLFYLSSFVGGLSVLYHESWLWAPVMCWENYPNQTLKPSLYWWYLLELAFYLSLLIRLPFDVKRKDFKEQVIHHFVVVILMTFSYSANLLRIGSLVLLLHDSADYLLEACKMVNYTQYQHVCDALFLIFSLVFFYTRLVLFPTQILYTTYYESLGNRGPFFGYYFCNGLLMLLQLLHVFWSCLILRMLCSFIKKGQMEKDIRSDVEESDSSEEEEAGAQEPLQLKNGAARGPRPAPTDGLRSRVAGRLTRHTTAT

Gene Information

Entrez Gene ID
Gene Name
ceramide synthase 4
Gene Symbol
Species
Macaca mulatta

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005783 IEA:Ensembl C endoplasmic reticulum
GO:0016021 IEA:UniProtKB-KW C integral component of membrane
GO:0005634 IEA:UniProtKB-SubCell C nucleus
GO:0003677 IEA:UniProtKB-KW F DNA binding
GO:0050291 IEA:Ensembl F sphingosine N-acyltransferase activity
GO:0046513 IEA:Ensembl P ceramide biosynthetic process

KEGG Pathway Links

KEGG Pathway ID Description
M00094 Ceramide biosynthesis
mcc_M00094 Ceramide biosynthesis
mcc01100 Metabolic pathways
ko00600 Sphingolipid metabolism
mcc00600 Sphingolipid metabolism
M00099 Sphingosine biosynthesis
mcc_M00099 Sphingosine biosynthesis

Domain Information

InterPro Annotations

Accession Description
IPR001356 Homeobox domain
IPR009057 Homeodomain-like
IPR016439 Longevity assurance, LAG1/LAC1
IPR006634 TRAM/LAG1/CLN8 homology domain

UniProt Annotations

Entry Information

Gene Name
ceramide synthase 4
Protein Entry
F6V9L6_MACMU
UniProt ID
Species
Rhesus monkey

Comments

Comment Type Description
Caution The sequence shown here is derived from an Ensembl automatic analysis pipeline and should be considered as preliminary data.
Similarity Contains TLC (TRAM/LAG1/CLN8) domain.
Subcellular Location Nucleus

Identical and Related Proteins

Unique RefSeq proteins for LMP014289 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
109123226 RefSeq XP_001093577 394 ceramide synthase 4

Identical Sequences to LMP014289 proteins

Reference Database Accession Length Protein Name

Related Sequences to LMP014289 proteins

Reference Database Accession Length Protein Name
GI:109123226 RefSeq XP_009198145.1 394 PREDICTED: ceramide synthase 4 [Papio anubis]
GI:109123226 RefSeq XP_009198146.1 394 PREDICTED: ceramide synthase 4 [Papio anubis]
GI:109123226 RefSeq XP_009198148.1 394 PREDICTED: ceramide synthase 4 [Papio anubis]
GI:109123226 RefSeq XP_009198149.1 394 PREDICTED: ceramide synthase 4 [Papio anubis]