Gene/Proteome Database (LMPD)
Proteins
Refseq ID | XP_001108531 |
Protein GI | 109018365 |
UniProt ID | F7D1M7 |
mRNA ID | XM_001108590 |
Length | 370 |
MAMTLEEAPWLGWLLVKALMRFAFMVANNLVAIPSYICYVIILQPLRVLDSKRFWYIEGIMYKWLLGMVASWGWYAGYTVMEWGEDIKAVSKDEAVMLVNHQATGDVCTLMMCLQDKGLVVAQMMWLMDHIFKYTNFGIVSLVHGDFFIRQGRSYRDQQLLLLKKHLENNYRSRDRKWIVLFPEGGFLRKRRETSQAFAKKNNLPFLTNVTLPRSGATKIILNALVAQQKNGSPAGGDAKELDSKSKGLQWIIDTTIAYPKAEPIDIQTWILGYRKPTVTHVHYRIFPIKDVPLETDDLTTWLYQRFVEKEDLLSHFYETGAFPPSKGHKEAVSREMTLSNMWIFLIQSFAFLSGYMWYNIIQYFYHCLF |
Refseq ID | XP_001108590 |
Protein GI | 109018367 |
UniProt ID | F7D1M7 |
mRNA ID | XM_001108590 |
Length | 370 |
Protein sequence is identical to GI:109018365 (mRNA isoform) |
Gene Information
Entrez Gene ID
Gene Name
lysophosphatidylglycerol acyltransferase 1
Gene Symbol
Species
Macaca mulatta
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0005737 | IEA:Ensembl | C | cytoplasm |
GO:0016020 | IEA:Ensembl | C | membrane |
GO:0016746 | IEA:InterPro | F | transferase activity, transferring acyl groups |
KEGG Pathway Links
Domain Information
InterPro Annotations
Accession | Description |
---|---|
IPR002123 | Phospholipid/glycerol acyltransferase |
UniProt Annotations
Entry Information
Gene Name
lysophosphatidylglycerol acyltransferase 1
Protein Entry
F7D1M7_MACMU
UniProt ID
Species
Rhesus monkey
Identical and Related Proteins
Unique RefSeq proteins for LMP014321 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
109018365 | RefSeq | XP_001108531 | 370 | lysophosphatidylglycerol acyltransferase 1 |
Identical Sequences to LMP014321 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:109018365 | GenBank | EHH15570.1 | 370 | hypothetical protein EGK_01680 [Macaca mulatta] |
GI:109018365 | RefSeq | XP_001108590.1 | 370 | PREDICTED: acyl-CoA:lysophosphatidylglycerol acyltransferase 1 isoform 2 [Macaca mulatta] |
GI:109018365 | RefSeq | XP_007986705.1 | 370 | PREDICTED: acyl-CoA:lysophosphatidylglycerol acyltransferase 1 isoform X4 [Chlorocebus sabaeus] |
Related Sequences to LMP014321 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:109018365 | RefSeq | XP_005540821.1 | 382 | PREDICTED: acyl-CoA:lysophosphatidylglycerol acyltransferase 1 isoform X2 [Macaca fascicularis] |