Gene/Proteome Database (LMPD)
Proteins
| Refseq ID | XP_001108531 |
| Protein GI | 109018365 |
| UniProt ID | F7D1M7 |
| mRNA ID | XM_001108590 |
| Length | 370 |
| MAMTLEEAPWLGWLLVKALMRFAFMVANNLVAIPSYICYVIILQPLRVLDSKRFWYIEGIMYKWLLGMVASWGWYAGYTVMEWGEDIKAVSKDEAVMLVNHQATGDVCTLMMCLQDKGLVVAQMMWLMDHIFKYTNFGIVSLVHGDFFIRQGRSYRDQQLLLLKKHLENNYRSRDRKWIVLFPEGGFLRKRRETSQAFAKKNNLPFLTNVTLPRSGATKIILNALVAQQKNGSPAGGDAKELDSKSKGLQWIIDTTIAYPKAEPIDIQTWILGYRKPTVTHVHYRIFPIKDVPLETDDLTTWLYQRFVEKEDLLSHFYETGAFPPSKGHKEAVSREMTLSNMWIFLIQSFAFLSGYMWYNIIQYFYHCLF | |
| Refseq ID | XP_001108590 |
| Protein GI | 109018367 |
| UniProt ID | F7D1M7 |
| mRNA ID | XM_001108590 |
| Length | 370 |
| Protein sequence is identical to GI:109018365 (mRNA isoform) | |
Gene Information
Entrez Gene ID
Gene Name
lysophosphatidylglycerol acyltransferase 1
Gene Symbol
Species
Macaca mulatta
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005737 | IEA:Ensembl | C | cytoplasm |
| GO:0016020 | IEA:Ensembl | C | membrane |
| GO:0016746 | IEA:InterPro | F | transferase activity, transferring acyl groups |
KEGG Pathway Links
Domain Information
InterPro Annotations
| Accession | Description |
|---|---|
| IPR002123 | Phospholipid/glycerol acyltransferase |
UniProt Annotations
Entry Information
Gene Name
lysophosphatidylglycerol acyltransferase 1
Protein Entry
F7D1M7_MACMU
UniProt ID
Species
Rhesus monkey
Identical and Related Proteins
Unique RefSeq proteins for LMP014321 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 109018365 | RefSeq | XP_001108531 | 370 | lysophosphatidylglycerol acyltransferase 1 |
Identical Sequences to LMP014321 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:109018365 | GenBank | EHH15570.1 | 370 | hypothetical protein EGK_01680 [Macaca mulatta] |
| GI:109018365 | RefSeq | XP_001108590.1 | 370 | PREDICTED: acyl-CoA:lysophosphatidylglycerol acyltransferase 1 isoform 2 [Macaca mulatta] |
| GI:109018365 | RefSeq | XP_007986705.1 | 370 | PREDICTED: acyl-CoA:lysophosphatidylglycerol acyltransferase 1 isoform X4 [Chlorocebus sabaeus] |
Related Sequences to LMP014321 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:109018365 | RefSeq | XP_005540821.1 | 382 | PREDICTED: acyl-CoA:lysophosphatidylglycerol acyltransferase 1 isoform X2 [Macaca fascicularis] |