Gene/Proteome Database (LMPD)

LMPD ID
LMP014333
Gene ID
Species
Macaca mulatta (Rhesus monkey)
Gene Name
leukotriene C4 synthase
Gene Symbol
Alternate Names
leukotriene C4 synthase;
Chromosome
6
Map Location
chromosome:6

Proteins

Refseq ID XP_001101985
Protein GI 109080107
UniProt ID F7EF92
mRNA ID XM_001101985
Length 150
MKDEVALLATVTLLGVLLQAYFSLQVISARRAFRVSPPLTTGPPEFERVYRAQVNCSEYFPLFLATLWVAGIFFHEGAAALCGLVYLFARLRYFQGYASSAQLRLAPLYASARALWLLVALAALGLLAHFLPAALRAALLGRLRTLLPWA

Gene Information

Entrez Gene ID
Gene Name
leukotriene C4 synthase
Gene Symbol
Species
Macaca mulatta

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005783 IEA:Ensembl C endoplasmic reticulum
GO:0016021 IEA:InterPro C integral component of membrane
GO:0005635 IEA:Ensembl C nuclear envelope
GO:0008047 IEA:InterPro F enzyme activator activity
GO:0004464 IEA:Ensembl F leukotriene-C4 synthase activity
GO:0008289 IEA:Ensembl F lipid binding
GO:0006691 IEA:Ensembl P leukotriene metabolic process

KEGG Pathway Links

KEGG Pathway ID Description
ko00590 Arachidonic acid metabolism
mcc00590 Arachidonic acid metabolism
mcc01100 Metabolic pathways

Domain Information

InterPro Annotations

Accession Description
IPR001446 5-lipoxygenase-activating protein
IPR018295 FLAP/GST2/LTC4S, conserved site
IPR023352 Membrane associated eicosanoid/glutathione metabolism-like domain
IPR001129 Membrane-associated, eicosanoid/glutathione metabolism (MAPEG) protein

UniProt Annotations

Entry Information

Gene Name
leukotriene C4 synthase
Protein Entry
F7EF92_MACMU
UniProt ID
Species
Rhesus monkey

Identical and Related Proteins

Unique RefSeq proteins for LMP014333 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
109080107 RefSeq XP_001101985 150 leukotriene C4 synthase

Identical Sequences to LMP014333 proteins

Reference Database Accession Length Protein Name

Related Sequences to LMP014333 proteins

Reference Database Accession Length Protein Name
GI:109080107 GenBank AFE78252.1 150 leukotriene C4 synthase [Macaca mulatta]
GI:109080107 RefSeq XP_003900680.1 150 PREDICTED: leukotriene C4 synthase [Papio anubis]
GI:109080107 RefSeq XP_005558833.1 150 PREDICTED: leukotriene C4 synthase isoform X2 [Macaca fascicularis]
GI:109080107 RefSeq XP_008013713.1 150 PREDICTED: leukotriene C4 synthase [Chlorocebus sabaeus]