Gene/Proteome Database (LMPD)
Proteins
| Refseq ID | XP_001101985 |
| Protein GI | 109080107 |
| UniProt ID | F7EF92 |
| mRNA ID | XM_001101985 |
| Length | 150 |
| MKDEVALLATVTLLGVLLQAYFSLQVISARRAFRVSPPLTTGPPEFERVYRAQVNCSEYFPLFLATLWVAGIFFHEGAAALCGLVYLFARLRYFQGYASSAQLRLAPLYASARALWLLVALAALGLLAHFLPAALRAALLGRLRTLLPWA | |
Gene Information
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005783 | IEA:Ensembl | C | endoplasmic reticulum |
| GO:0016021 | IEA:InterPro | C | integral component of membrane |
| GO:0005635 | IEA:Ensembl | C | nuclear envelope |
| GO:0008047 | IEA:InterPro | F | enzyme activator activity |
| GO:0004464 | IEA:Ensembl | F | leukotriene-C4 synthase activity |
| GO:0008289 | IEA:Ensembl | F | lipid binding |
| GO:0006691 | IEA:Ensembl | P | leukotriene metabolic process |
KEGG Pathway Links
Domain Information
UniProt Annotations
Entry Information
Gene Name
leukotriene C4 synthase
Protein Entry
F7EF92_MACMU
UniProt ID
Species
Rhesus monkey
Identical and Related Proteins
Unique RefSeq proteins for LMP014333 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 109080107 | RefSeq | XP_001101985 | 150 | leukotriene C4 synthase |
Identical Sequences to LMP014333 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|
Related Sequences to LMP014333 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:109080107 | GenBank | AFE78252.1 | 150 | leukotriene C4 synthase [Macaca mulatta] |
| GI:109080107 | RefSeq | XP_003900680.1 | 150 | PREDICTED: leukotriene C4 synthase [Papio anubis] |
| GI:109080107 | RefSeq | XP_005558833.1 | 150 | PREDICTED: leukotriene C4 synthase isoform X2 [Macaca fascicularis] |
| GI:109080107 | RefSeq | XP_008013713.1 | 150 | PREDICTED: leukotriene C4 synthase [Chlorocebus sabaeus] |