Gene/Proteome Database (LMPD)

LMPD ID
LMP014335
Gene ID
Species
Macaca mulatta (Rhesus monkey)
Gene Name
lysophospholipase II
Gene Symbol
Alternate Names
acyl-protein thioesterase 2;
Chromosome
1
Map Location
chromosome:1

Proteins

acyl-protein thioesterase 2
Refseq ID NP_001253628
Protein GI 388490416
UniProt ID F7CKN2
mRNA ID NM_001266699
Length 231
Protein sequence is identical to GI:297282486 (mRNA isoform)
Refseq ID XP_001112696
Protein GI 297282486
UniProt ID F7CKN2
mRNA ID XM_001112696
Length 231
MCGNTMSVPLLTDAATVSGAERETAAVIFLHGLGDTGHSWADALSTIRLPHVKYICPHAPRIPVTLNMKMVMPSWFDLMGLSPDAPEDEAGIKKAAENIKALIEHEMKNGIPANRIVLGGFSQGGALSLYTALTCPHPLAGIVALSCWLPLHRAFPQAANGSAKDLAILQCHGELDPMVPVRFGALTAEKLRSVVTPARVQFKTYPGVMHSSCPQEMAAVKEFLEKLLPPV

Gene Information

Entrez Gene ID
Gene Name
lysophospholipase II
Gene Symbol
Species
Macaca mulatta

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0016787 IEA:InterPro F hydrolase activity

KEGG Pathway Links

KEGG Pathway ID Description
ko00564 Glycerophospholipid metabolism
mcc00564 Glycerophospholipid metabolism

Domain Information

InterPro Annotations

Accession Description
IPR029058 Alpha/Beta hydrolase fold
IPR003140 Phospholipase/carboxylesterase/thioesterase

UniProt Annotations

Entry Information

Gene Name
lysophospholipase II
Protein Entry
F7CKN2_MACMU
UniProt ID
Species
Rhesus monkey

Identical and Related Proteins

Unique RefSeq proteins for LMP014335 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
297282486 RefSeq XP_001112696 231 lysophospholipase II

Identical Sequences to LMP014335 proteins

Reference Database Accession Length Protein Name
GI:388490416 RefSeq XP_008692835.1 231 PREDICTED: acyl-protein thioesterase 2 [Ursus maritimus]
GI:388490416 RefSeq XP_008961367.1 231 PREDICTED: acyl-protein thioesterase 2 isoform X2 [Pan paniscus]
GI:388490416 RefSeq XP_009448865.1 231 PREDICTED: acyl-protein thioesterase 2 isoform X1 [Pan troglodytes]
GI:388490416 RefSeq XP_010354065.1 231 PREDICTED: acyl-protein thioesterase 2 [Rhinopithecus roxellana]

Related Sequences to LMP014335 proteins

Reference Database Accession Length Protein Name
GI:388490416 GenBank AFH28310.1 231 acyl-protein thioesterase 2 [Macaca mulatta]
GI:388490416 GenBank JAB11071.1 231 acyl-protein thioesterase 2 [Callithrix jacchus]
GI:388490416 GenBank JAB17567.1 231 acyl-protein thioesterase 2 [Callithrix jacchus]
GI:388490416 GenBank JAB23381.1 231 acyl-protein thioesterase 2 [Callithrix jacchus]