Gene/Proteome Database (LMPD)
Proteins
| acyl-protein thioesterase 2 | |
|---|---|
| Refseq ID | NP_001253628 |
| Protein GI | 388490416 |
| UniProt ID | F7CKN2 |
| mRNA ID | NM_001266699 |
| Length | 231 |
| Protein sequence is identical to GI:297282486 (mRNA isoform) | |
| Refseq ID | XP_001112696 |
| Protein GI | 297282486 |
| UniProt ID | F7CKN2 |
| mRNA ID | XM_001112696 |
| Length | 231 |
| MCGNTMSVPLLTDAATVSGAERETAAVIFLHGLGDTGHSWADALSTIRLPHVKYICPHAPRIPVTLNMKMVMPSWFDLMGLSPDAPEDEAGIKKAAENIKALIEHEMKNGIPANRIVLGGFSQGGALSLYTALTCPHPLAGIVALSCWLPLHRAFPQAANGSAKDLAILQCHGELDPMVPVRFGALTAEKLRSVVTPARVQFKTYPGVMHSSCPQEMAAVKEFLEKLLPPV | |
Gene Information
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0016787 | IEA:InterPro | F | hydrolase activity |
KEGG Pathway Links
Domain Information
UniProt Annotations
Entry Information
Identical and Related Proteins
Unique RefSeq proteins for LMP014335 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 297282486 | RefSeq | XP_001112696 | 231 | lysophospholipase II |
Identical Sequences to LMP014335 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:388490416 | RefSeq | XP_008692835.1 | 231 | PREDICTED: acyl-protein thioesterase 2 [Ursus maritimus] |
| GI:388490416 | RefSeq | XP_008961367.1 | 231 | PREDICTED: acyl-protein thioesterase 2 isoform X2 [Pan paniscus] |
| GI:388490416 | RefSeq | XP_009448865.1 | 231 | PREDICTED: acyl-protein thioesterase 2 isoform X1 [Pan troglodytes] |
| GI:388490416 | RefSeq | XP_010354065.1 | 231 | PREDICTED: acyl-protein thioesterase 2 [Rhinopithecus roxellana] |
Related Sequences to LMP014335 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:388490416 | GenBank | AFH28310.1 | 231 | acyl-protein thioesterase 2 [Macaca mulatta] |
| GI:388490416 | GenBank | JAB11071.1 | 231 | acyl-protein thioesterase 2 [Callithrix jacchus] |
| GI:388490416 | GenBank | JAB17567.1 | 231 | acyl-protein thioesterase 2 [Callithrix jacchus] |
| GI:388490416 | GenBank | JAB23381.1 | 231 | acyl-protein thioesterase 2 [Callithrix jacchus] |