Gene/Proteome Database (LMPD)
Proteins
| Refseq ID | XP_001116334 |
| Protein GI | 109094688 |
| mRNA ID | XM_001116334 |
| Length | 260 |
| MKVTVGPDPSLVYRPDVDPEVAKDKASFRNYTSGPLLDRVFTTYKLMHTHQTVDFVRGKHAQFGGFSYKKMTVMEAVDLLDGLVDESDPDVDFPNSFHAFQTAEGIRKAHPDKDWFHLVGLLHDLGKVLALFGEPQWAVVGDTFPVGCRPQASVVFRDSTFQDNPDLQDPRYSTELGMYQPHCGLDRVLMSWGHDAFYPWHTGSDYQQLCSQQDLSMLPWVQEFNKFDLYTKCPDLPDVDKLRPYYQGLIDKYCPGILSW | |
Gene Information
Domain Information
InterPro Annotations
| Accession | Description |
|---|
UniProt Annotations
Entry Information
Gene Name
myo-inositol oxygenase
Species
Rhesus monkey
Identical and Related Proteins
Unique RefSeq proteins for LMP014371 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 109094688 | RefSeq | XP_001116334 | 260 |
Identical Sequences to LMP014371 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|
Related Sequences to LMP014371 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:109094688 | RefSeq | XP_003905803.1 | 285 | PREDICTED: inositol oxygenase [Papio anubis] |
| GI:109094688 | RefSeq | XP_005566953.1 | 285 | PREDICTED: inositol oxygenase isoform X2 [Macaca fascicularis] |
| GI:109094688 | RefSeq | XP_007974441.1 | 285 | PREDICTED: inositol oxygenase isoform X2 [Chlorocebus sabaeus] |
| GI:109094688 | RefSeq | XP_010353169.1 | 285 | PREDICTED: inositol oxygenase [Rhinopithecus roxellana] |