Gene/Proteome Database (LMPD)
Proteins
Refseq ID | XP_001086603 |
Protein GI | 109107978 |
UniProt ID | F6YBC1 |
mRNA ID | XM_001086603 |
Length | 334 |
MVEFAPLFVPWERRLQTLAVLQFVFSFLALAEICIVGFIALLFTRFWLLTVLYAAWWYLDRDKPRQGGRRVQAIRCWTIWKYMKDYFPISLVKTAELDPSRNYIVGFHPHGVLAAGAFANLCTESTGFSSIFPGIRPHLMMLTLWFRAPFFRDYIMSAGLVTSEKESAAHILNRKGGGNLLGIIVGGAQEALDARPGSFTLLLRNRKGFIRLALTHGAPLVPIFSFGENDLFDQIPNSSGSWLRCIQNRLQKIMGISLPLFHGRGVFQYSFGLIPYRRPITTVVGKPIEVQKTLHPSEEEVNQLHQRYIKELCNLFEAHKLKFNIPADQHLEFC |
Gene Information
Entrez Gene ID
Gene Name
monoacylglycerol O-acyltransferase 2
Gene Symbol
Species
Macaca mulatta
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0005783 | IEA:Ensembl | C | endoplasmic reticulum |
GO:0016407 | IEA:Ensembl | F | acetyltransferase activity |
GO:0006651 | IEA:Ensembl | P | diacylglycerol biosynthetic process |
GO:0050892 | IEA:Ensembl | P | intestinal absorption |
KEGG Pathway Links
Domain Information
InterPro Annotations
Accession | Description |
---|---|
IPR007130 | Diacylglycerol acyltransferase |
UniProt Annotations
Entry Information
Gene Name
monoacylglycerol O-acyltransferase 2
Protein Entry
F6YBC1_MACMU
UniProt ID
Species
Rhesus monkey
Identical and Related Proteins
Unique RefSeq proteins for LMP014376 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
109107978 | RefSeq | XP_001086603 | 334 | monoacylglycerol O-acyltransferase 2 |
Identical Sequences to LMP014376 proteins
Reference | Database | Accession | Length | Protein Name |
---|
Related Sequences to LMP014376 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:109107978 | GenBank | EHH23258.1 | 334 | hypothetical protein EGK_06693 [Macaca mulatta] |
GI:109107978 | GenBank | EHH56594.1 | 334 | hypothetical protein EGM_06042 [Macaca fascicularis] |
GI:109107978 | RefSeq | XP_003910482.1 | 334 | PREDICTED: 2-acylglycerol O-acyltransferase 2 [Papio anubis] |
GI:109107978 | RefSeq | XP_005579169.1 | 334 | PREDICTED: 2-acylglycerol O-acyltransferase 2 isoform X1 [Macaca fascicularis] |