Gene/Proteome Database (LMPD)
Proteins
| Refseq ID | XP_001112404 |
| Protein GI | 109111568 |
| UniProt ID | F6PU89 |
| mRNA ID | XM_001112404 |
| Length | 156 |
| MASRVLSAYVRRLPAAFAPLPRVPMLAVAQPLSTGLCSAGTQTRLGPLQPALRLAQVPGRVTQLCRQDSDMPPLTLEGIQDCVLYVLKLYDKIDPEKLSVDSHFMKDLGLDGLDQVEIIMAMEDEFGFEIPDIDAEKLMCPQEIVDYIADKKDVYE | |
Gene Information
Entrez Gene ID
Gene Name
NADH dehydrogenase (ubiquinone) 1, alpha/beta subcomplex, 1, 8kDa
Gene Symbol
Species
Macaca mulatta
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0006633 | IEA:UniProtKB-KW | P | fatty acid biosynthetic process |
KEGG Pathway Links
| KEGG Pathway ID | Description |
|---|---|
| ko05010 | Alzheimer's disease |
| mcc05010 | Alzheimer's disease |
| ko05016 | Huntington's disease |
| mcc05016 | Huntington's disease |
| mcc01100 | Metabolic pathways |
| M00146 | NADH dehydrogenase (ubiquinone) 1 alpha subcomplex |
| mcc_M00146 | NADH dehydrogenase (ubiquinone) 1 alpha subcomplex |
| ko04932 | Non-alcoholic fatty liver disease (NAFLD) |
| mcc04932 | Non-alcoholic fatty liver disease (NAFLD) |
| ko00190 | Oxidative phosphorylation |
| mcc00190 | Oxidative phosphorylation |
| mcc05012 | Parkinson's disease |
Domain Information
UniProt Annotations
Entry Information
Gene Name
NADH dehydrogenase (ubiquinone) 1, alpha/beta subcomplex, 1, 8kDa
Protein Entry
F6PU89_MACMU
UniProt ID
Species
Rhesus monkey
Comments
| Comment Type | Description |
|---|---|
| Caution | The sequence shown here is derived from an Ensembl automatic analysis pipeline and should be considered as preliminary data. |
| Function | Carrier of the growing fatty acid chain in fatty acid biosynthesis. |
| Similarity | Contains 1 acyl carrier domain. |
Identical and Related Proteins
Unique RefSeq proteins for LMP014404 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 109111568 | RefSeq | XP_001112404 | 156 | NADH dehydrogenase (ubiquinone) 1, alpha/beta subcomplex, 1, 8kDa |
Identical Sequences to LMP014404 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|
Related Sequences to LMP014404 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:109111568 | GenBank | EHH31513.1 | 156 | Acyl carrier protein, mitochondrial [Macaca mulatta] |
| GI:109111568 | GenBank | AFE78394.1 | 156 | acyl carrier protein, mitochondrial precursor [Macaca mulatta] |
| GI:109111568 | RefSeq | XP_005581815.1 | 156 | PREDICTED: acyl carrier protein, mitochondrial-like [Macaca fascicularis] |
| GI:109111568 | RefSeq | XP_009181339.1 | 156 | PREDICTED: acyl carrier protein, mitochondrial [Papio anubis] |