Gene/Proteome Database (LMPD)

LMPD ID
LMP014420
Gene ID
699881
Species
Macaca mulatta (Rhesus monkey)
Gene Name
Niemann-Pick disease, type C2
Gene Symbol
NPC2
Alternate Names
epididymal secretory protein E1;
Chromosome
7
Map Location
chromosome:7

Proteins

epididymal secretory protein E1 precursor
Refseq ID NP_001253689
Protein GI 388452626
UniProt ID F7HRU3
mRNA ID NM_001266760
Length 151
Protein sequence is identical to GI:109084311 (mRNA isoform)
sig_peptide: 1..19 inference: COORDINATES: ab initio prediction:SignalP:4.0 calculated_mol_wt: 2009 peptide sequence: MRFLAATFLLLALSTAAQA
Refseq ID XP_001094066
Protein GI 109084311
UniProt ID F7HRU3
mRNA ID XM_002805165
Length 151
MRFLAATFLLLALSTAAQAEPVQFKDCGSVDGVIKEVNVSPCPTQPCQLSKGQSYSVNVTFTSNIQSKSSKAVVHGILMGVPVPFPIPEPDGCKSGINCPIQKDKTYSYLNKLPVKSEYPSIKLVVEWQLQDDKNQSLFCWEIPVQIVSHL
sig_peptide: 1..19 inference: COORDINATES: ab initio prediction:SignalP:4.0 calculated_mol_wt: 2009 peptide sequence: MRFLAATFLLLALSTAAQA
Refseq ID XP_002805211
Protein GI 297298264
UniProt ID F7HRU3
mRNA ID XM_002805165
Length 125
MRFLAATFLLLALSTAAQAEPVQFKDCGSVDGVIKEVNVSPCPTQPCQLSKGQSYSVNVTFTSNIQSKSSKAVVHGILMGVPVPFPIPEPDGCKSGINCPIQKDKTYSYLNKLPVKSEYPSVSHL
sig_peptide: 1..19 inference: COORDINATES: ab initio prediction:SignalP:4.0 calculated_mol_wt: 2009 peptide sequence: MRFLAATFLLLALSTAAQA

Gene Information

Entrez Gene ID
699881
Gene Name
Niemann-Pick disease, type C2
Gene Symbol
NPC2
Species
Macaca mulatta

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0070062 IEA:Ensembl C extracellular vesicular exosome
GO:0005764 IEA:Ensembl C lysosome
GO:0015485 IEA:Ensembl F cholesterol binding
GO:0033344 IEA:Ensembl P cholesterol efflux
GO:0042632 IEA:Ensembl P cholesterol homeostasis
GO:0032367 IEA:Ensembl P intracellular cholesterol transport
GO:0009615 IEA:Ensembl P response to virus

KEGG Pathway Links

KEGG Pathway ID Description
ko04142 Lysosome
mcc04142 Lysosome

Domain Information

InterPro Annotations

Accession Description
IPR014756 Immunoglobulin E-set
IPR003172 MD-2-related lipid-recognition domain

UniProt Annotations

Entry Information

Gene Name
Niemann-Pick disease, type C2
Protein Entry
F7HRU3_MACMU
UniProt ID
F7HRU3
Species
Rhesus monkey

Identical and Related Proteins

Unique RefSeq proteins for LMP014420 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
109084311 RefSeq XP_001094066 151 Niemann-Pick disease, type C2
297298264 RefSeq XP_002805211 125 Niemann-Pick disease, type C2

Identical Sequences to LMP014420 proteins

Reference Database Accession Length Protein Name
GI:388452626 GenBank AIC50666.1 151 NPC2, partial [synthetic construct]
GI:388452626 RefSeq XP_007985463.1 151 PREDICTED: epididymal secretory protein E1 [Chlorocebus sabaeus]
GI:388452626 RefSeq XP_009210222.1 151 PREDICTED: epididymal secretory protein E1 [Papio anubis]
GI:388452626 RefSeq XP_009426323.1 151 PREDICTED: epididymal secretory protein E1 isoform X1 [Pan troglodytes]

Related Sequences to LMP014420 proteins

Reference Database Accession Length Protein Name
GI:388452626 GenBank AAH02532.1 151 Niemann-Pick disease, type C2 [Homo sapiens]
GI:388452626 GenBank ABA85880.1 151 Sequence 7812 from patent US 6783961
GI:388452626 GenBank JAA15843.1 151 Niemann-Pick disease, type C2 [Pan troglodytes]
GI:388452626 GenBank JAA37628.1 151 Niemann-Pick disease, type C2 [Pan troglodytes]