Gene/Proteome Database (LMPD)
LMPD ID
LMP014449
Gene ID
Species
Macaca mulatta (Rhesus monkey)
Gene Name
nudix (nucleoside diphosphate linked moiety X)-type motif 4
Gene Symbol
Alternate Names
diphosphoinositol polyphosphate phosphohydrolase 2; diphosphoinositol polyphosphate phosphohydrolase 2 isoform alpha;
Chromosome
11
Map Location
chromosome:11
Proteins
| diphosphoinositol polyphosphate phosphohydrolase 2 | |
|---|---|
| Refseq ID | NP_001248184 |
| Protein GI | 386781792 |
| UniProt ID | H9EU90 |
| mRNA ID | NM_001261255 |
| Length | 180 |
| Protein sequence is identical to GI:297263248 (mRNA isoform) | |
| Refseq ID | XP_001105592 |
| Protein GI | 297263248 |
| UniProt ID | H9EU90 |
| mRNA ID | XM_001105592 |
| Length | 180 |
| MMKFKPNQTRTYDREGFKKRAACLCFRSEQEDEVLLVSSSRYPDQWIVPGGGMEPEEEPGGAAVREVYEEAGVKGKLGRLLGIFENQDRKHRTYVYVLTVTEILEDWEDSVNIGRKREWFKVEDAIKVLQCHKPVHAEYLEKLKLGCSPANGNSTVPSLPDNNALFVTAAQTSGLPSSIR | |
Gene Information
Entrez Gene ID
Gene Name
nudix (nucleoside diphosphate linked moiety X)-type motif 4
Gene Symbol
Species
Macaca mulatta
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0008486 | IEA:Ensembl | F | diphosphoinositol-polyphosphate diphosphatase activity |
| GO:0030515 | IEA:Ensembl | F | snoRNA binding |
Domain Information
UniProt Annotations
Entry Information
Gene Name
nudix (nucleoside diphosphate linked moiety X)-type motif 4
Protein Entry
H9EU90_MACMU
UniProt ID
Species
Rhesus monkey
Identical and Related Proteins
Unique RefSeq proteins for LMP014449 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 297263248 | RefSeq | XP_001105592 | 180 | nudix (nucleoside diphosphate linked moiety X)-type motif 4 |
Identical Sequences to LMP014449 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:386781792 | GenBank | AFE65949.1 | 180 | diphosphoinositol polyphosphate phosphohydrolase 2 isoform alpha [Macaca mulatta] |
| GI:386781792 | GenBank | AFH28229.1 | 180 | diphosphoinositol polyphosphate phosphohydrolase 2 isoform alpha [Macaca mulatta] |
| GI:386781792 | RefSeq | NP_001270192.1 | 180 | uncharacterized protein LOC101867035 [Macaca fascicularis] |
| GI:386781792 | RefSeq | XP_008002434.1 | 180 | PREDICTED: diphosphoinositol polyphosphate phosphohydrolase 2 isoform X2 [Chlorocebus sabaeus] |
Related Sequences to LMP014449 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:386781792 | DBBJ | BAE91688.1 | 180 | unnamed protein product [Macaca fascicularis] |