Gene/Proteome Database (LMPD)
Proteins
| platelet-activating factor acetylhydrolase IB subunit beta | |
|---|---|
| Refseq ID | NP_001244668 |
| Protein GI | 383873043 |
| UniProt ID | F6WXP0 |
| mRNA ID | NM_001257739 |
| Length | 229 |
| Protein sequence is identical to GI:297269270 (mRNA isoform) | |
| Refseq ID | XP_002799854 |
| Protein GI | 297269270 |
| UniProt ID | F6WXP0 |
| mRNA ID | XM_002799808 |
| Length | 229 |
| MSQGDSNPAAIPHAAEDIQGDDRWMSQHNRFVLDCKDKEPDVLFVGDSMVQLMQQYEIWRELFSPLHALNFGIGGDTTRHVLWRLKNGELENIKPKVIVVWVGTNNHENTAEEVAGGIEAIVQLINTRQPQAKIIVLGLLPRGEKPNPLRQKNAKVNQLLKVSLPKLANVQLLDTDGGFVHSDGAISCHDMFDFLHLTGGGYAKICKPLHELIMQLLEETPEEKQTTIA | |
| Refseq ID | XP_001091325 |
| Protein GI | 297269272 |
| UniProt ID | F6WXP0 |
| mRNA ID | XM_002799808 |
| Length | 181 |
| MVQLMQQYEIWRELFSPLHALNFGIGGDTTRHVLWRLKNGELENIKPKVIVVWVGTNNHENTAEEVAGGIEAIVQLINTRQPQAKIIVLGLLPRGEKPNPLRQKNAKVNQLLKVSLPKLANVQLLDTDGGFVHSDGAISCHDMFDFLHLTGGGYAKICKPLHELIMQLLEETPEEKQTTIA | |
Gene Information
Entrez Gene ID
Gene Name
platelet-activating factor acetylhydrolase 1b, catalytic subunit 2 (30kDa)
Gene Symbol
Species
Macaca mulatta
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005737 | IEA:Ensembl | C | cytoplasm |
| GO:0070062 | IEA:Ensembl | C | extracellular vesicular exosome |
| GO:0005730 | IEA:Ensembl | C | nucleolus |
| GO:0005886 | IEA:Ensembl | C | plasma membrane |
| GO:0016787 | IEA:UniProtKB-KW | F | hydrolase activity |
| GO:0016239 | IEA:Ensembl | P | positive regulation of macroautophagy |
| GO:0007283 | IEA:Ensembl | P | spermatogenesis |
KEGG Pathway Links
Domain Information
InterPro Annotations
| Accession | Description |
|---|---|
| IPR013831 | SGNH_hydro-type_esterase_dom |
UniProt Annotations
Entry Information
Gene Name
platelet-activating factor acetylhydrolase 1b, catalytic subunit 2 (30kDa)
Protein Entry
F6WXP0_MACMU
UniProt ID
Species
Rhesus monkey
Identical and Related Proteins
Unique RefSeq proteins for LMP014472 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 297269270 | RefSeq | XP_002799854 | 229 | platelet-activating factor acetylhydrolase 1b, catalytic subunit 2 (30kDa) |
| 297269272 | RefSeq | XP_001091325 | 181 | platelet-activating factor acetylhydrolase 1b, catalytic subunit 2 (30kDa) |
Identical Sequences to LMP014472 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:383873043 | RefSeq | XP_008259129.1 | 229 | PREDICTED: platelet-activating factor acetylhydrolase IB subunit beta [Oryctolagus cuniculus] |
| GI:383873043 | RefSeq | XP_008688260.1 | 229 | PREDICTED: platelet-activating factor acetylhydrolase IB subunit beta [Ursus maritimus] |
| GI:383873043 | RefSeq | XP_008849153.1 | 229 | PREDICTED: platelet-activating factor acetylhydrolase IB subunit beta isoform X1 [Nannospalax galili] |
| GI:383873043 | RefSeq | XP_010365705.1 | 229 | PREDICTED: platelet-activating factor acetylhydrolase IB subunit beta [Rhinopithecus roxellana] |
Related Sequences to LMP014472 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:383873043 | DBBJ | BAA19917.1 | 229 | acetylhydrolase IB beta-subunit [Homo sapiens] |
| GI:383873043 | GenBank | AFE78482.1 | 229 | platelet-activating factor acetylhydrolase IB subunit beta isoform a [Macaca mulatta] |
| GI:383873043 | GenBank | AFH32580.1 | 229 | platelet-activating factor acetylhydrolase IB subunit beta isoform a [Macaca mulatta] |
| GI:383873043 | GenBank | AFH32581.1 | 229 | platelet-activating factor acetylhydrolase IB subunit beta isoform a [Macaca mulatta] |