Gene/Proteome Database (LMPD)
Proteins
| Refseq ID | XP_001091544 |
| Protein GI | 109086781 |
| UniProt ID | F7EDD7 |
| mRNA ID | XM_001091544 |
| Length | 432 |
| MGPMGSLLGSGQMQITLWGSLATVAIFFVITFLIFLCSSCDREKKPRQHSGDHENLMNVPSDKEMFSRSVTSLATDAPASSEQNGALTNGDILSEDSTLTCMQHYEEVQTSASDLLDSQDSTGKPKCHQCRELPRIPPESAVDTMLTVRSADGDQGPGMEGPYEVLKDSSSQENMVEDCLYETVKEIKEVAAAAHLEKGHTGKAKPTSASKELPGPQTEGKAEFAEYASVDRNKKCRQSVNVESILGNSCDLEEEAPPPVPVKLLDENENLQEKEAGEAEESATDRTSETNKRFSSLSYKSREEDPTLTEEEISAMYSSVNKPGQLGNKSGQSLTVPESTYTSIQEDPQRSPSSCNDLYATVKDFEKTPNSTFPPAGRPGEEPEPDYEAIQTLHREEEKATLGTNGHRGLVPKENDYESISDLQQGRDITRL | |
Gene Information
Entrez Gene ID
Gene Name
phosphoprotein associated with glycosphingolipid microdomains 1
Gene Symbol
Species
Macaca mulatta
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0045121 | IEA:Ensembl | C | membrane raft |
| GO:0005886 | IEA:Ensembl | C | plasma membrane |
| GO:0035556 | IEA:Ensembl | P | intracellular signal transduction |
| GO:0050868 | IEA:Ensembl | P | negative regulation of T cell activation |
Domain Information
InterPro Annotations
| Accession | Description |
|---|
UniProt Annotations
Entry Information
Gene Name
phosphoprotein associated with glycosphingolipid microdomains 1
Protein Entry
F7EDD7_MACMU
UniProt ID
Species
Rhesus monkey
Comments
| Comment Type | Description |
|---|---|
| Caution | The sequence shown here is derived from an Ensembl automatic analysis pipeline and should be considered as preliminary data. |
| Caution | The sequence shown here is derived from an Ensembl automatic analysis pipeline and should be considered as preliminary data. {ECO:0000313|Ensembl:ENSMMUP00000030719}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP014474 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 109086781 | RefSeq | XP_001091544 | 432 | phosphoprotein associated with glycosphingolipid microdomains 1 |
Identical Sequences to LMP014474 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|
Related Sequences to LMP014474 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:109086781 | GenBank | EHH64258.1 | 432 | Transmembrane adapter protein PAG [Macaca fascicularis] |
| GI:109086781 | GenBank | AFE66845.1 | 432 | phosphoprotein associated with glycosphingolipid-enriched microdomains 1 [Macaca mulatta] |
| GI:109086781 | GenBank | AFH27699.1 | 432 | phosphoprotein associated with glycosphingolipid-enriched microdomains 1 [Macaca mulatta] |
| GI:109086781 | RefSeq | XP_005563673.1 | 432 | PREDICTED: phosphoprotein associated with glycosphingolipid-enriched microdomains 1 [Macaca fascicularis] |