Gene/Proteome Database (LMPD)

LMPD ID
LMP014474
Gene ID
Species
Macaca mulatta (Rhesus monkey)
Gene Name
phosphoprotein associated with glycosphingolipid microdomains 1
Gene Symbol
Alternate Names
phosphoprotein associated with glycosphingolipid microdomains 1;
Chromosome
8
Map Location
chromosome:8

Proteins

Refseq ID XP_001091544
Protein GI 109086781
UniProt ID F7EDD7
mRNA ID XM_001091544
Length 432
MGPMGSLLGSGQMQITLWGSLATVAIFFVITFLIFLCSSCDREKKPRQHSGDHENLMNVPSDKEMFSRSVTSLATDAPASSEQNGALTNGDILSEDSTLTCMQHYEEVQTSASDLLDSQDSTGKPKCHQCRELPRIPPESAVDTMLTVRSADGDQGPGMEGPYEVLKDSSSQENMVEDCLYETVKEIKEVAAAAHLEKGHTGKAKPTSASKELPGPQTEGKAEFAEYASVDRNKKCRQSVNVESILGNSCDLEEEAPPPVPVKLLDENENLQEKEAGEAEESATDRTSETNKRFSSLSYKSREEDPTLTEEEISAMYSSVNKPGQLGNKSGQSLTVPESTYTSIQEDPQRSPSSCNDLYATVKDFEKTPNSTFPPAGRPGEEPEPDYEAIQTLHREEEKATLGTNGHRGLVPKENDYESISDLQQGRDITRL

Gene Information

Entrez Gene ID
Gene Name
phosphoprotein associated with glycosphingolipid microdomains 1
Gene Symbol
Species
Macaca mulatta

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0045121 IEA:Ensembl C membrane raft
GO:0005886 IEA:Ensembl C plasma membrane
GO:0035556 IEA:Ensembl P intracellular signal transduction
GO:0050868 IEA:Ensembl P negative regulation of T cell activation

Domain Information

InterPro Annotations

Accession Description

UniProt Annotations

Entry Information

Gene Name
phosphoprotein associated with glycosphingolipid microdomains 1
Protein Entry
F7EDD7_MACMU
UniProt ID
Species
Rhesus monkey

Comments

Comment Type Description
Caution The sequence shown here is derived from an Ensembl automatic analysis pipeline and should be considered as preliminary data.
Caution The sequence shown here is derived from an Ensembl automatic analysis pipeline and should be considered as preliminary data. {ECO:0000313|Ensembl:ENSMMUP00000030719}.

Identical and Related Proteins

Unique RefSeq proteins for LMP014474 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
109086781 RefSeq XP_001091544 432 phosphoprotein associated with glycosphingolipid microdomains 1

Identical Sequences to LMP014474 proteins

Reference Database Accession Length Protein Name

Related Sequences to LMP014474 proteins

Reference Database Accession Length Protein Name
GI:109086781 GenBank EHH64258.1 432 Transmembrane adapter protein PAG [Macaca fascicularis]
GI:109086781 GenBank AFE66845.1 432 phosphoprotein associated with glycosphingolipid-enriched microdomains 1 [Macaca mulatta]
GI:109086781 GenBank AFH27699.1 432 phosphoprotein associated with glycosphingolipid-enriched microdomains 1 [Macaca mulatta]
GI:109086781 RefSeq XP_005563673.1 432 PREDICTED: phosphoprotein associated with glycosphingolipid-enriched microdomains 1 [Macaca fascicularis]