Gene/Proteome Database (LMPD)

LMPD ID
LMP014547
Gene ID
Species
Macaca mulatta (Rhesus monkey)
Gene Name
phosphatidylinositol glycan anchor biosynthesis, class K
Gene Symbol
Alternate Names
GPI-anchor transamidase;
Chromosome
1
Map Location
chromosome:1

Proteins

GPI-anchor transamidase precursor
Refseq ID NP_001247873
Protein GI 386781394
UniProt ID F6V958
mRNA ID NM_001260944
Length 395
Protein sequence is identical to GI:109008530 (mRNA isoform)
sig_peptide: 1..27 inference: COORDINATES: ab initio prediction:SignalP:4.0 calculated_mol_wt: 2679 peptide sequence: MAVTYSLSRPAAALVAVLLLSFGSVAA
Refseq ID XP_001102474
Protein GI 109008530
UniProt ID F6V958
mRNA ID XM_001102474
Length 395
MAVTYSLSRPAAALVAVLLLSFGSVAARHIEDQAEQFFRSGHTNNWAVLVCTSRFWFNYRHVANTLSVYRSVKRLGIPDSHIVLMLADDMACNPRNPKPATVFSHKNMELNVYGDDVEVDYRSYEVTVENFLRVLTGRIPPSTPRSKRLLSDDRSNILIYMTGHGGNGFLKFQDSEEITNIELADAFEQMWQKRRYNELLFIIDTCQGASMYERFYSPNIMALASSQVGEDSLSHQPDPAIGVHLMDRYTFYVLEFLEEINPASQTNMNDLFQVCPKSLCVSTPGHRTDLFQRDPKNVLITDFFGSVRKVEITTETINLQQGSEIMESSYKEDQMDEELMEPLKYAEQLPVAQIIHQKPKLKDWHPPGGFILGLWALIIMVFFKTYGIKHMKFIF
sig_peptide: 1..27 inference: COORDINATES: ab initio prediction:SignalP:4.0 calculated_mol_wt: 2679 peptide sequence: MAVTYSLSRPAAALVAVLLLSFGSVAA
Refseq ID XP_002801634
Protein GI 297278984
UniProt ID F6V958
mRNA ID XM_001102474
Length 319
MAVTYSLSRPAAALVAVLLLSFGSVAARHIEDQAEQFFRSGHTNNWAVLVTVENFLRVLTGRIPPSTPRSKRLLSDDRSNILIYMTGHGGNGFLKFQDSEEITNIELADAFEQMWQKRRYNELLFIIDTCQGASMYERFYSPNIMALASSQVGEDSLSHQPDPAIGVHLMDRYTFYVLEFLEEINPASQTNMNDLFQVCPKSLCVSTPGHRTDLFQRDPKNVLITDFFGSVRKVEITTETINLQQGSEIMESSYKEDQMDEELMEPLKYAEQLPVAQIIHQKPKLKDWHPPGGFILGLWALIIMVFFKTYGIKHMKFIF
sig_peptide: 1..27 inference: COORDINATES: ab initio prediction:SignalP:4.0 calculated_mol_wt: 2679 peptide sequence: MAVTYSLSRPAAALVAVLLLSFGSVAA

Gene Information

Entrez Gene ID
Gene Name
phosphatidylinositol glycan anchor biosynthesis, class K
Gene Symbol
Species
Macaca mulatta

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0042765 IEA:Ensembl C GPI-anchor transamidase complex
GO:0004197 IEA:InterPro F cysteine-type endopeptidase activity
GO:0003923 IEA:Ensembl F GPI-anchor transamidase activity
GO:0016255 IEA:InterPro P attachment of GPI anchor to protein

KEGG Pathway Links

KEGG Pathway ID Description
ko00563 Glycosylphosphatidylinositol(GPI)-anchor biosynthesis
mcc00563 Glycosylphosphatidylinositol(GPI)-anchor biosynthesis
mcc01100 Metabolic pathways

Domain Information

InterPro Annotations

Accession Description
IPR028361 GPI-anchor transamidase
IPR001096 Peptidase C13, legumain

UniProt Annotations

Entry Information

Gene Name
phosphatidylinositol glycan anchor biosynthesis, class K
Protein Entry
F6V958_MACMU
UniProt ID
Species
Rhesus monkey

Identical and Related Proteins

Unique RefSeq proteins for LMP014547 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
109008530 RefSeq XP_001102474 395 phosphatidylinositol glycan anchor biosynthesis, class K
297278984 RefSeq XP_002801634 319 phosphatidylinositol glycan anchor biosynthesis, class K

Identical Sequences to LMP014547 proteins

Reference Database Accession Length Protein Name
GI:386781394 GenBank AFE76133.1 395 GPI-anchor transamidase precursor [Macaca mulatta]
GI:386781394 GenBank AFH30638.1 395 GPI-anchor transamidase precursor [Macaca mulatta]
GI:386781394 RefSeq XP_005543039.1 395 PREDICTED: GPI-anchor transamidase [Macaca fascicularis]

Related Sequences to LMP014547 proteins

Reference Database Accession Length Protein Name
GI:386781394 GenBank EHH50010.1 395 hypothetical protein EGM_00767 [Macaca fascicularis]