Gene/Proteome Database (LMPD)
Proteins
| Refseq ID | XP_001088273 |
| Protein GI | 297272015 |
| mRNA ID | XM_001088273 |
| Length | 101 |
| MEAMWFLCVAAAVVAWGFLWVWDSSERVKSREQGERLGAESRTLLAIAHPDDEAMFFAPTVLGLARLRHWVYLLCFSAGISQMTQVCSGTQSMWPASSSST | |
Gene Information
Domain Information
InterPro Annotations
| Accession | Description |
|---|
UniProt Annotations
Entry Information
Gene Name
phosphatidylinositol glycan anchor biosynthesis, class L
Species
Rhesus monkey
Identical and Related Proteins
Unique RefSeq proteins for LMP014548 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 297272015 | RefSeq | XP_001088273 | 101 |
Identical Sequences to LMP014548 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|
Related Sequences to LMP014548 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:297272015 | DBBJ | BAG58868.1 | 101 | unnamed protein product [Homo sapiens] |
| GI:297272015 | RefSeq | XP_005583033.1 | 252 | PREDICTED: N-acetylglucosaminyl-phosphatidylinositol de-N-acetylase isoform X1 [Macaca fascicularis] |
| GI:297272015 | RefSeq | XP_005583034.1 | 210 | PREDICTED: N-acetylglucosaminyl-phosphatidylinositol de-N-acetylase isoform X2 [Macaca fascicularis] |
| GI:297272015 | RefSeq | XP_008008902.1 | 125 | PREDICTED: N-acetylglucosaminyl-phosphatidylinositol de-N-acetylase-like [Chlorocebus sabaeus] |