Gene/Proteome Database (LMPD)
Proteins
| Refseq ID | XP_001104302 |
| Protein GI | 109089338 |
| mRNA ID | XM_001104302 |
| Length | 194 |
| MKLASGFLVLWLSLGVVLAQSDTSPDAEESYSDWGLRHLRGSFESVNSYFDSFLELLGGKNGVCQYRCRYGKAPMPRPGYKPQEPNGCGSYFLGLKVPESMDLGIPAMTKCCNQLDVCYDTCGANKYRCDAKFRWCLHSICSDLKRSLGFVSKVEACDSLVDTVFNTVWTLGCRPFMNSQRAACICAEEEKEEL | |
Gene Information
Domain Information
InterPro Annotations
| Accession | Description |
|---|
UniProt Annotations
Entry Information
Gene Name
phospholipase A2, group XIIB
Species
Rhesus monkey
Identical and Related Proteins
Unique RefSeq proteins for LMP014588 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 109089338 | RefSeq | XP_001104302 | 194 |
Identical Sequences to LMP014588 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:109089338 | RefSeq | XP_005565596.1 | 194 | PREDICTED: group XIIB secretory phospholipase A2-like protein isoform X2 [Macaca fascicularis] |
Related Sequences to LMP014588 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:109089338 | GenBank | EHH64764.1 | 195 | hypothetical protein EGM_18072 [Macaca fascicularis] |
| GI:109089338 | RefSeq | XP_007961283.1 | 194 | PREDICTED: group XIIB secretory phospholipase A2-like protein isoform X2 [Chlorocebus sabaeus] |
| GI:109089338 | RefSeq | XP_009212974.1 | 194 | PREDICTED: group XIIB secretory phospholipase A2-like protein isoform X2 [Papio anubis] |