Gene/Proteome Database (LMPD)
Proteins
Refseq ID | XP_001094731 |
Protein GI | 108998704 |
UniProt ID | F7EHU8 |
mRNA ID | XM_001094731 |
Length | 144 |
MKTLLLLAVIMIFGLLQAHGNLVDFRRMIKLKTGKEAALSYGFYGCHCGVGGKGAPKDATDRCCVVHDCCYKRLEKRGCGTKFLSYKFSNKGSTITCAKQDSCRSQLCECDKAAAYCFARNKSTYNKNYQYYSNKFCRGSTPRC |
Gene Information
Entrez Gene ID
Gene Name
phospholipase A2, group IIA (platelets, synovial fluid)
Gene Symbol
Species
Macaca mulatta
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0005783 | IEA:Ensembl | C | endoplasmic reticulum |
GO:0005615 | IEA:Ensembl | C | extracellular space |
GO:0005739 | IEA:Ensembl | C | mitochondrion |
GO:0005509 | IEA:InterPro | F | calcium ion binding |
GO:0004623 | IEA:Ensembl | F | phospholipase A2 activity |
GO:0005543 | IEA:Ensembl | F | phospholipid binding |
GO:0016042 | IEA:InterPro | P | lipid catabolic process |
GO:0050680 | IEA:Ensembl | P | negative regulation of epithelial cell proliferation |
GO:0046473 | IEA:Ensembl | P | phosphatidic acid metabolic process |
GO:0035019 | IEA:Ensembl | P | somatic stem cell maintenance |
KEGG Pathway Links
KEGG Pathway ID | Description |
---|---|
ko00590 | Arachidonic acid metabolism |
mcc00590 | Arachidonic acid metabolism |
ko00565 | Ether lipid metabolism |
mcc00565 | Ether lipid metabolism |
ko04975 | Fat digestion and absorption |
mcc04975 | Fat digestion and absorption |
ko00564 | Glycerophospholipid metabolism |
mcc00564 | Glycerophospholipid metabolism |
ko00591 | Linoleic acid metabolism |
mcc00591 | Linoleic acid metabolism |
mcc01100 | Metabolic pathways |
ko04972 | Pancreatic secretion |
mcc04972 | Pancreatic secretion |
mcc04014 | Ras signaling pathway |
ko04270 | Vascular smooth muscle contraction |
mcc04270 | Vascular smooth muscle contraction |
ko00592 | alpha-Linolenic acid metabolism |
mcc00592 | alpha-Linolenic acid metabolism |
Domain Information
UniProt Annotations
Entry Information
Gene Name
phospholipase A2, group IIA (platelets, synovial fluid)
Protein Entry
F7EHU8_MACMU
UniProt ID
Species
Rhesus monkey
Comments
Comment Type | Description |
---|---|
Catalytic Activity | Phosphatidylcholine + H(2)O = 1- acylglycerophosphocholine + a carboxylate. |
Cofactor | Note=Binds 1 calcium ion per subunit. ; |
Similarity | Belongs to the phospholipase A2 family. |
Subcellular Location | Secreted |
Identical and Related Proteins
Unique RefSeq proteins for LMP014592 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
108998704 | RefSeq | XP_001094731 | 144 | phospholipase A2, group IIA (platelets, synovial fluid) |
Identical Sequences to LMP014592 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:108998704 | GenBank | EHH14401.1 | 144 | hypothetical protein EGK_00322 [Macaca mulatta] |
Related Sequences to LMP014592 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:108998704 | GenBank | EHH49604.1 | 144 | hypothetical protein EGM_00293 [Macaca fascicularis] |
GI:108998704 | RefSeq | XP_005544624.1 | 144 | PREDICTED: phospholipase A2, membrane associated [Macaca fascicularis] |
GI:108998704 | RefSeq | XP_009199061.1 | 144 | PREDICTED: phospholipase A2, membrane associated [Papio anubis] |