Gene/Proteome Database (LMPD)
Proteins
Refseq ID | XP_001109144 |
Protein GI | 109094494 |
UniProt ID | F6VKY9 |
mRNA ID | XM_001109144 |
Length | 481 |
MYDAERGWSLSFAGCGFLGFYHVGATRCLSEHAPHLLRDARMLFGASAGALHCVGVLSGIPLEQTLQVLSDLVRKARSRNIGIFHPSFNIGKFLRQDLYKYLPANVHQLISGKICVSLTRVSDGENVLVSDFQSKDEVVDALICSCFIPFYSGLIPPSFRGVRYVDGGASDNVPFIDAKTTITVSPFYGEYDICPKVKSTNFLHVDITKLSLRLCTGNLYLLSRAFVPPDLKVLGEICLRGYLDAFRFLEEKGICNKPQRGLKSSSEGMDSEVTAPGWENTSLDSSPEPAALAMRLDGDELLDHLRLSILPWDESILDTLSPELATAVSEAMKDKGGYMSKICNLLPIRIMSYVMLPCTLPVESAIAIVQRLVTWLPDMPDDVQWLQWVTSQVFTRALMCLLPASRSQMPVSGEQASPCKPEQDWHCWTPCSPEDCPAEAKAEATPRSILRSSLNFFWGNKVPAGAEGLSTFPSFSLEKNL |
Gene Information
Entrez Gene ID
Gene Name
patatin-like phospholipase domain containing 3
Gene Symbol
Species
Macaca mulatta
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0016020 | IEA:Ensembl | C | membrane |
GO:0051265 | IEA:Ensembl | F | diolein transacylation activity |
GO:0051264 | IEA:Ensembl | F | mono-olein transacylation activity |
GO:0004623 | IEA:Ensembl | F | phospholipase A2 activity |
GO:0004806 | IEA:Ensembl | F | triglyceride lipase activity |
GO:0019432 | IEA:Ensembl | P | triglyceride biosynthetic process |
KEGG Pathway Links
KEGG Pathway ID | Description |
---|---|
M00098 | Acylglycerol degradation |
mcc_M00098 | Acylglycerol degradation |
ko00561 | Glycerolipid metabolism |
mcc00561 | Glycerolipid metabolism |
mcc01100 | Metabolic pathways |
Domain Information
UniProt Annotations
Entry Information
Gene Name
patatin-like phospholipase domain containing 3
Protein Entry
F6VKY9_MACMU
UniProt ID
Species
Rhesus monkey
Comments
Comment Type | Description |
---|---|
Caution | The sequence shown here is derived from an Ensembl automatic analysis pipeline and should be considered as preliminary data. |
Similarity | Contains patatin domain. |
Identical and Related Proteins
Unique RefSeq proteins for LMP014646 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
109094494 | RefSeq | XP_001109144 | 481 | patatin-like phospholipase domain containing 3 |
Identical Sequences to LMP014646 proteins
Reference | Database | Accession | Length | Protein Name |
---|
Related Sequences to LMP014646 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:109094494 | RefSeq | XP_003905722.1 | 477 | PREDICTED: patatin-like phospholipase domain-containing protein 3 isoform X1 [Papio anubis] |
GI:109094494 | RefSeq | XP_005567108.1 | 481 | PREDICTED: patatin-like phospholipase domain-containing protein 3 isoform X1 [Macaca fascicularis] |
GI:109094494 | RefSeq | XP_007974227.1 | 481 | PREDICTED: patatin-like phospholipase domain-containing protein 3 isoform X1 [Chlorocebus sabaeus] |
GI:109094494 | RefSeq | XP_007974228.1 | 480 | PREDICTED: patatin-like phospholipase domain-containing protein 3 isoform X2 [Chlorocebus sabaeus] |