Gene/Proteome Database (LMPD)

LMPD ID
LMP014646
Gene ID
Species
Macaca mulatta (Rhesus monkey)
Gene Name
patatin-like phospholipase domain containing 3
Gene Symbol
Alternate Names
patatin-like phospholipase domain containing 3;
Chromosome
10
Map Location
chromosome:10

Proteins

Refseq ID XP_001109144
Protein GI 109094494
UniProt ID F6VKY9
mRNA ID XM_001109144
Length 481
MYDAERGWSLSFAGCGFLGFYHVGATRCLSEHAPHLLRDARMLFGASAGALHCVGVLSGIPLEQTLQVLSDLVRKARSRNIGIFHPSFNIGKFLRQDLYKYLPANVHQLISGKICVSLTRVSDGENVLVSDFQSKDEVVDALICSCFIPFYSGLIPPSFRGVRYVDGGASDNVPFIDAKTTITVSPFYGEYDICPKVKSTNFLHVDITKLSLRLCTGNLYLLSRAFVPPDLKVLGEICLRGYLDAFRFLEEKGICNKPQRGLKSSSEGMDSEVTAPGWENTSLDSSPEPAALAMRLDGDELLDHLRLSILPWDESILDTLSPELATAVSEAMKDKGGYMSKICNLLPIRIMSYVMLPCTLPVESAIAIVQRLVTWLPDMPDDVQWLQWVTSQVFTRALMCLLPASRSQMPVSGEQASPCKPEQDWHCWTPCSPEDCPAEAKAEATPRSILRSSLNFFWGNKVPAGAEGLSTFPSFSLEKNL

Gene Information

Entrez Gene ID
Gene Name
patatin-like phospholipase domain containing 3
Gene Symbol
Species
Macaca mulatta

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0016020 IEA:Ensembl C membrane
GO:0051265 IEA:Ensembl F diolein transacylation activity
GO:0051264 IEA:Ensembl F mono-olein transacylation activity
GO:0004623 IEA:Ensembl F phospholipase A2 activity
GO:0004806 IEA:Ensembl F triglyceride lipase activity
GO:0019432 IEA:Ensembl P triglyceride biosynthetic process

KEGG Pathway Links

KEGG Pathway ID Description
M00098 Acylglycerol degradation
mcc_M00098 Acylglycerol degradation
ko00561 Glycerolipid metabolism
mcc00561 Glycerolipid metabolism
mcc01100 Metabolic pathways

Domain Information

InterPro Annotations

Accession Description
IPR016035 Acyl transferase/acyl hydrolase/lysophospholipase
IPR002641 Patatin/Phospholipase A2-related

UniProt Annotations

Entry Information

Gene Name
patatin-like phospholipase domain containing 3
Protein Entry
F6VKY9_MACMU
UniProt ID
Species
Rhesus monkey

Comments

Comment Type Description
Caution The sequence shown here is derived from an Ensembl automatic analysis pipeline and should be considered as preliminary data.
Similarity Contains patatin domain.

Identical and Related Proteins

Unique RefSeq proteins for LMP014646 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
109094494 RefSeq XP_001109144 481 patatin-like phospholipase domain containing 3

Identical Sequences to LMP014646 proteins

Reference Database Accession Length Protein Name

Related Sequences to LMP014646 proteins

Reference Database Accession Length Protein Name
GI:109094494 RefSeq XP_003905722.1 477 PREDICTED: patatin-like phospholipase domain-containing protein 3 isoform X1 [Papio anubis]
GI:109094494 RefSeq XP_005567108.1 481 PREDICTED: patatin-like phospholipase domain-containing protein 3 isoform X1 [Macaca fascicularis]
GI:109094494 RefSeq XP_007974227.1 481 PREDICTED: patatin-like phospholipase domain-containing protein 3 isoform X1 [Chlorocebus sabaeus]
GI:109094494 RefSeq XP_007974228.1 480 PREDICTED: patatin-like phospholipase domain-containing protein 3 isoform X2 [Chlorocebus sabaeus]