Gene/Proteome Database (LMPD)
Proteins
| patatin-like phospholipase domain-containing protein 4 | |
|---|---|
| Refseq ID | NP_001180773 |
| Protein GI | 302564249 |
| UniProt ID | F7E9K3 |
| mRNA ID | NM_001193844 |
| Length | 253 |
| Protein sequence is identical to GI:109129851 (mRNA isoform) | |
| Refseq ID | XP_001089320 |
| Protein GI | 109129851 |
| UniProt ID | F7E9K3 |
| mRNA ID | XM_001089320 |
| Length | 253 |
| MKHINLSFAACGFLGIYHLGAASALCRHGKKLLKDVKAFAGASAGSLVASVLLTAPEKIEECNQFTYKFAEEIRRQSFGAVTPGYDIMAQLRSGMESILPPNAHELAQNRLHVSITNTRTRENHLVSTFSSREDLIKVLLASSFVPIYAGLKPVEYKGQKWVDGGLTNALPILPVGRTVTISPFSGRLDISPQDKGQLDLYVNIAKQDIMLSLANLVRLNQALFPPSKRKMESLYQCGFDDTIKFLLKENWFE | |
Gene Information
Entrez Gene ID
Gene Name
patatin-like phospholipase domain containing 4
Gene Symbol
Species
Macaca mulatta
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0006629 | IEA:InterPro | P | lipid metabolic process |
KEGG Pathway Links
Domain Information
UniProt Annotations
Entry Information
Gene Name
patatin-like phospholipase domain containing 4
Protein Entry
F7E9K3_MACMU
UniProt ID
Species
Rhesus monkey
Comments
| Comment Type | Description |
|---|---|
| Caution | The sequence shown here is derived from an Ensembl automatic analysis pipeline and should be considered as preliminary data. |
| Similarity | Contains patatin domain. |
Identical and Related Proteins
Unique RefSeq proteins for LMP014647 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 109129851 | RefSeq | XP_001089320 | 253 | patatin-like phospholipase domain containing 4 |
Identical Sequences to LMP014647 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:302564249 | GenBank | EHH60692.1 | 253 | Patatin-like phospholipase domain-containing protein 4 [Macaca fascicularis] |
| GI:302564249 | RefSeq | XP_005592976.1 | 253 | PREDICTED: patatin-like phospholipase domain-containing protein 4 isoform X1 [Macaca fascicularis] |
| GI:302564249 | RefSeq | XP_005592977.1 | 253 | PREDICTED: patatin-like phospholipase domain-containing protein 4 isoform X2 [Macaca fascicularis] |
| GI:302564249 | RefSeq | XP_005592978.1 | 253 | PREDICTED: patatin-like phospholipase domain-containing protein 4 isoform X3 [Macaca fascicularis] |
Related Sequences to LMP014647 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|